KEGG   Thamnophis sirtalis: 106554995Help
Entry
106554995         CDS       T06107                                 

Definition
(RefSeq) cAMP-responsive element modulator-like
  KO
K09052  cAMP response element modulator
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106554995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsr03000]
    106554995
Transcription factors [BR:tsr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106554995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID
Motif
Other DBs
NCBI-GeneID: 106554995
NCBI-ProteinID: XP_013929230
Position
Unknown
AA seq 309 aa AA seqDB search
MLHLTCNMWRQMTMETVEPQDGSATDSITESDSANMQSPIGQNQISTIAQVSVAGSTTGR
GSPSVTVVQFPSGQTVHVQGVIQATQSSVIQSPQLQSVQVAPATNADESTESEVVIDSQK
RREILSRRPSYRKILNELSSDAPGVAKIEEGKPEEEGAPSGIPAMAVPTSLYQTSTGQYI
AIAQGGTIQISNPASDGVQGLQTLTMTNSGAPQPGATIVQYAAQTPDGTQQFFVPGSQVV
VQAATGDMPTYQIRTPTTALPQGVVMAASPGTLHNPQQLAEEATRKRELRLMKNRYQLEF
KLIFICLFI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttgacttgtaacatgtggagacaaatgaccatggaaacagttgaaccacaa
gatggcagtgcaacagactctattacagaaagtgattctgctaacatgcaatccccaatc
ggccaaaatcagatctccactatagctcaagtttctgtagcaggatcaacaactggaaga
ggatctccctctgtaactgtagtgcagttcccttctggtcaaactgtccacgtacaggga
gtgattcaagctacacagtcttcggtaattcagtcaccacagttgcaatctgttcaggta
gcgccagctacaaatgcagatgaatctacagaatccgaggtggtaattgattctcagaag
cggagggagatactttcaaggaggccttcgtatcgaaaaattctgaatgagctttcttct
gatgcacctggcgttgctaagattgaagaaggaaaaccagaggaagaaggagcaccttct
ggaattcctgccatggctgtgccaaccagcctttatcaaactagcaccgggcagtacatt
gctatagcccaaggtggaaccatccagatttccaatccagcatctgatggtgttcaagga
ctacaaacattaacgatgacaaattcaggagctcctcaacctggtgctacgattgtacaa
tatgcagctcaaacacctgatggcactcaacagttcttcgtacctgggagtcaggttgtt
gtccaagctgctacaggtgacatgccaacttaccaaatccgtactccaaccacagcctta
cctcaaggagtcgtcatggcagcttccccaggaacactgcataacccgcagcagctagca
gaagaagcaacgcgtaaaagagaactaaggcttatgaaaaacaggtaccaattagaattc
aagttaatatttatttgtttgtttatt

DBGET integrated database retrieval system