KEGG   Thamnophis sirtalis: 106555287Help
Entry
106555287         CDS       T06107                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04136  Autophagy - other
tsr04140  Autophagy - animal
tsr04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106555287 (ATG16L1)
   04136 Autophagy - other
    106555287 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106555287 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsr04131]
    106555287 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:tsr03029]
    106555287 (ATG16L1)
Membrane trafficking [BR:tsr04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106555287 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106555287 (ATG16L1)
Mitochondrial biogenesis [BR:tsr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106555287 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A KASH_CCD Fez1 Lipoprotein_6 DUF2332
Motif
Other DBs
NCBI-GeneID: 106555287
NCBI-ProteinID: XP_013929617
Position
Unknown
AA seq 623 aa AA seqDB search
MSVGLKTSSFPTWKRHILDELKRRDRLQRQAFEEIILQYNKLLEKSDFHSVLADKLQVEK
YDLPSRHEISPGHDGARNDAHLQEVAQLRIKHQEELTELHKKRGELAQTVIDLNNQIQQK
DKEIQINNVKIAEYLQKISELETECHDLCNKLQDLEQANQTLKDEYDALQITFNALEEKL
RKTTEDNQELVTRWMAEKAQEANRLNAENEKDLRRRQARLQKELAEAAKEPLPIEQDDDI
EVLADETSDPAEETSPVRAVTRTASKRLSQPTGGLLDSINNIFGLSESPLLGHHSSDTAR
RRSLSSCPIPQDNTDEHPTASREVRLPNTAVYVFDAHDGEVNAVQFSPGSRLLATGGLDR
RVKIWDVFGDKCEFKASLSGSNAGITSVEFDNAGSYLLAASNDYASRIWTMDDHRLRHTL
TGHSGKVLSAKFLLDKARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDLVCTEQCVMS
GHFDKKIRFWDIRTESVIQEMELLGRITALDLNPERTELLTCSRDDLLKIIDLRINAVKH
TFSAPGFKCGSDWTRVVFSPDGNYVAAGSADGSLYIWSVLTGKVERTLSKHHSNPINAVA
WSPSGAHVVSVDKGNKAVLWSEF
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttggacttaagacctcgagcttccccacctggaagcggcatatcctggacgaa
ctgaagcgtcgagaccggttacaaagacaggcctttgaagagatcatcttgcaatataat
aagctcttggagaagtcagatttccattcagtgctggctgacaagctacaagtggaaaag
tatgatttgccaagccggcatgagatcagcccaggacatgatggtgcaagaaatgatgct
catcttcaagaagtcgctcaattaaggattaaacatcaagaggaattgacagagctgcac
aagaaacggggcgagttggctcaaactgtgattgacctaaacaatcaaatacaacagaag
gacaaagaaatacaaataaataatgtcaaaattgcagaatatttacagaagatatctgaa
ctggagactgagtgccatgatttatgcaacaagcttcaagatcttgaacaagctaatcaa
actcttaaggatgaatatgatgctctccaaatcacctttaatgctcttgaagaaaaatta
agaaaaaccactgaagataaccaagaactggtaacccgttggatggcagaaaaggctcaa
gaagctaatcgcctcaatgcagaaaatgagaaagatttaagaagaaggcaagctcggctt
cagaaagaactagcagaagctgctaaagaaccactgccaattgaacaggatgatgatatt
gaagtccttgctgatgaaacctccgatccagctgaggagacatctccagttcgtgctgtc
acacgaacagcaagtaagcgactctcccagcccactggaggccttctggattctatcaat
aatatctttggtctgtctgagtctccccttttgggacatcactcttctgatactgccagg
agacgttctttatcctcatgtcctatccctcaagataatactgatgaacatcctactgca
agcagagaggtccgactacctaacacagcagtgtatgtctttgatgcacacgatggggag
gttaacgcagtccaattcagccctggttctcgtttattagcaacaggaggcttggaccgg
agggtcaaaatttgggatgtttttggtgataagtgtgaatttaaagcctccctatctggc
agtaatgcagggattactagtgtagagtttgataacgctggttcctacttattagcagct
tcaaatgactatgccagtaggatctggacaatggatgatcatcggttacgtcacacgctc
acggggcatagtggaaaggttttatcagcaaaattccttctggacaaagctcgcattgta
tctgggagtcatgacagaacactcaagctatgggacctgcgcagcaaagtctgtataaaa
acagtatttgctggctccagctgcaatgatcttgtctgtacagaacaatgtgtaatgagt
ggacactttgataagaaaattcgcttttgggatattagaactgaaagtgtgatacaggaa
atggaattgctgggaaggattacagctctagatctcaaccctgagagaacagagcttctt
acatgttctcgtgatgatctgttgaaaattattgatctcagaatcaacgctgtcaaacat
acattcagtgctccaggatttaaatgtgggtccgattggactagagttgtattcagccct
gatggaaattatgttgcggctggctcagcagatggatcactttatatatggagtgtgctc
actggaaaagtggaaaggacactttccaagcatcacagcaatcccatcaatgctgtggca
tggtcaccatctggagcccatgtggtcagtgtggacaaaggaaacaaggcggtgctgtgg
tctgaattttga

DBGET integrated database retrieval system