KEGG   Thamnophis sirtalis: 106556923
Entry
106556923         CDS       T06107                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106556923 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsr03000]
    106556923 (MECOM)
Transcription factors [BR:tsr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    106556923 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_11 zf-BED Zn-ribbon_8 zf-C2H2_8 zf-met PyrI_C
Other DBs
NCBI-GeneID: 106556923
NCBI-ProteinID: XP_013931440
Position
Unknown
AA seq 1074 aa
MKTDNYLHEEMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVDEEFQA
KLDKENDLHDMHDIQECKECDQVFSDVQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKSSMVNMTHANPGLSDYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLPSTDQTIKNQSPLMTHPQTLPATQEILKALNNH
PSNLSENKPLELQPERSSEERPHEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKCKENGKLFKDKVNSLQNLASVNNKKEYSNHSTFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKVEPQSP
GEGKKTLKGTSESPFDLTTKRKEEKPLTPVTSKTSVSSVASQDQPLDLSMGTRTRATGTK
QTEPRKNHIFGGKKGDQDLESRKSSDISLQHARPTPFFMDPIYRNVNLHCNQRRFTQELK
THCTIATQRGNQGVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQMPDQRTWMSAIENMAE
KLESFSSLKPDAGDLIQSVPSMFNFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLT
RHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHL
KKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSSHNNSEERMNGSHFK
DEKTPVVSQNSDLLEDEEAEDEVMMDEEDEESEITGKSVKELATSNICEEPSEGDFEEAN
ALEINCKSSPDRYKEDEFNKTGLSALDHIRHFTDSLKVRKLEENQFNETDLAAFTTSHLP
EDLKQPLHRKSKSQAYAMMLSLSDKDSLHSSSNMWHSMARAAAESGAIQSISHV
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgaagaccgacaattatttacatgaagagatggctcctgacattcatgaggagcgtcag
tatcggtgtgaagattgcgaccagctgtttgagtccaaagcggaactggtagaccatcag
aaattcccctgcagcactccccactcagcattttcaatggtggatgaagaatttcaggca
aaacttgacaaggagaatgatctccatgatatgcatgacatccaggaatgcaaagagtgt
gaccaagtattctctgatgtgcaaagcttggaaaagcacatgctgtcccacacagaagag
cgggaatataagtgtgaccaatgtcccaaggcctttaactggaaatcaaacttgatacgt
caccagatgtcccatgatagcgggaagcactacgaatgtgaaaactgcgccaaggttttc
acagaccccagcaacctccagaggcacatccgttcgcagcatgttggggctcgtgcgcat
gcttgtccagagtgcggtaaaacatttgccacttcttcaggcctcaaacagcacaaacat
atccacagcagtgtcaagccttttatatgtgaggtctgccataaatcctatactcagttt
tcaaacctttgccgtcataagcgtatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataagcacaggaggttttgtgag
ggcaagaaccattttgctgcaggaggattttttggccaaggcatatcacttcctggaacc
ccagctatggataaatcttccatggttaatatgactcatgcaaatccaggcctttctgac
tattttggcgccaatagacatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggcctgtttccttcaggcttgtatcacaggccacctttgatacctgct
agttctcctgttaaaggacttccaagcacagatcaaacaatcaaaaatcaaagtcccctc
atgacacatcctcagacattgccagctacccaggagattctgaaggcactaaataaccac
ccatctaacctaagtgaaaataagccactggagcttcaaccagaaaggtcctctgaagag
aggccacatgaaaagatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacc
cccagtgggagtgacctggagaccacctctggctctgatctcgaaagtgacattgaaagc
gataaagagaaatgtaaagaaaatggtaaactgttcaaagacaaagtaaactctctgcag
aatttggcttccgtaaataataagaaagaatacagcaatcattccaccttctcaccatct
ttagaggaacaaactgcggtgtcaggagctgtgaatgattctataaaagccattgcctct
attgctgaaaaatactttggttcgacaggacttgtggggctgcaggacaaaaaagtcgga
gccttaccttacccttccatgtttcccctcccattttttccagcattctctcagtcaatg
tatccattccctgatagagacttgagatcgttacctttgaaagtggaaccccaatctcca
ggagaagggaagaagactttaaagggaacctccgagtctccctttgaccttaccactaaa
cgtaaggaagagaaaccacttactcctgtaacttcaaaaacatcagtttcatcagtggcc
agccaggaccaacctctggacttgagcatgggcaccagaactcgagccacaggcacaaaa
cagaccgagcctcggaagaaccacatttttgggggaaagaaaggagaccaggatctcgaa
tcaaggaaatcctctgatatttccttacaacacgcaagacctacacctttctttatggat
cccatttacagaaatgtcaaccttcactgcaatcaaaggcgtttcacccaagaactcaaa
acacattgtaccatagcaacccaacgtggaaaccaaggagtagagaaaagaaagttaact
gatccacttgaagctttaaaggaaaagtatttgagaccatctccagggtttttatttcat
ccacaattccaaatgcctgatcaaagaacttggatgtccgccatagaaaacatggccgaa
aagctggaaagcttcagcagcctgaaaccagacgcaggtgacctcattcagtctgttcct
tccatgttcaacttcagggcccctcccaacaccttgcctgagaaccttcttcgcaagggg
aaggaacgttatacctgcagatactgtggcaagatttttccaagatctgcaaatctgact
cggcatctgaggacacacactggagaacagccatacaggtgcaaatactgtgacaggtct
ttcagcatatcatctaatctacagaggcatgtccggaatatccacaacaaggagaaaccc
tttaaatgtcatttatgtgacaggtgctttggccaacaaaccaacttagacagacatctc
aaaaagcatgaaaacggcaacatgtctggtactgctacatcttcacctcactcagaactt
gaaagcacaggggctatcttagatgataaagaagactcatactttacagaaattcggaat
tttattgggaatagcagtcacaataattcagaggaaagaatgaacggaagtcactttaag
gatgaaaagaccccagtagtaagccagaattcagacctgttggaagacgaagaagcagaa
gatgaagtaatgatggatgaggaagatgaagaaagtgaaataacagggaagtcagttaaa
gaactggcaacaagcaacatatgcgaagagccctcagagggtgattttgaagaagcaaat
gcattggaaataaattgcaaatcctctcctgacaggtataaggaagatgagtttaataaa
actggactttctgctttggaccacataaggcacttcactgatagtctcaaagtgaggaaa
ttagaagaaaaccagttcaatgaaactgacttggcggcattcaccacctcccatttgcca
gaagacttaaaacagccattgcatcgcaagtccaaatctcaggcttacgctatgatgctt
tcactctccgacaaggactctctacactcttcatccaacatgtggcacagtatggcgaga
gctgctgcggaatctggtgccatccagtccattagtcacgtatga

DBGET integrated database retrieval system