KEGG   Treponema succinifaciens: Tresu_0022Help
Entry
Tresu_0022        CDS       T01461                                 

Definition
(GenBank) Conserved hypothetical protein CHP03546
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2062
Motif
Other DBs
NCBI-ProteinID: AEB12992
UniProt: F2NU28
Position
complement(24769..25290)
Genome map
AA seq 173 aa AA seqDB search
MLKKIIKFFKALNSNSKPSELANALCLGIMLGFIPKNNALWFLIFIFFCFVRINKGLYFV
AMIVASQFAWLLDSKFDSIGFYILNYAPLTKTFSMLIDIPFVGFTKFNNTIVMGSFIFSL
IIYIPCFIFGIAFVKLWRKYVSSLFARTPIAKAIAKLPFAEKITSLITKDNAL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaaaatcataaaattctttaaagcactcaattcaaattcaaaaccatcggaa
cttgctaatgcgctctgccttggaatcatgcttggattcattccaaaaaacaatgcgctg
tggtttttaatttttatctttttctgctttgtgcgaataaacaaaggactttattttgtc
gcaatgattgtggcttcccagtttgcctggctcttggattcaaaattcgattcaatcgga
ttttacatcttgaactatgcgccgttgacaaaaactttttccatgctgattgacattccg
tttgtaggatttacaaaattcaacaacacaattgtaatgggctcttttatattttctctt
attatttatattccatgttttatatttggaatcgcatttgtaaaactttggcgcaaatat
gtttcttcactttttgcacgcactccaattgcaaaagccatcgcaaagcttccatttgct
gaaaaaatcacaagccttattacaaaggacaatgctttatga

DBGET integrated database retrieval system