KEGG   Treponema succinifaciens: Tresu_0024Help
Entry
Tresu_0024        CDS       T01461                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02050  NitT/TauT family transport system permease protein
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsu02000]
    Tresu_0024
Transporters [BR:tsu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Tresu_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 SMC_N AAA_23 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEB12994
UniProt: F2NU30
Position
26454..27917
Genome map
AA seq 487 aa AA seqDB search
MNKKKIFVFSIAFFFLLWKFFSLVIDSPLVLPSPESVAADFFSLAVEKNFLKSLAFTFFR
VFCAFFISSFLGILFGFLCTKFSVLKFFFELPLTFIRSVPLVSVILIVLFWLGSDSVPVF
AAVLLSFPVMFTSAFSGFSFEDKKMENVCTIFKITEMQKFLFLKIPYAKEFLKDAMENSC
GMIWKAVAAAEVLSVPKFALGSQLQNFQVVLEISKVFAVTIFIVLLGFLSEKILLIFFFA
LKKFYKNFINFYFQSDFFKLPHLSLEKEFFVELKNFCIEHDGKFIFKNYSENFDQKKITS
IVSPSGSGKTTLLDFVSENFSSVSYSMQTPNLFLNLSVFQNVQLPLLNIFGRKKSFEITQ
NILNNFGLNGKEKSCVEKISGGERQRVSLARAVAFPSGILLLDESFQFLDFSVKKKCIEF
ILERQKENPQTVIFAANEIKEAVLFSDKIIFYSSCPMLPLKTFLVSAEDKKNPAALEKEI
LALLFSL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaaaaaagatttttgttttttctattgcattttttttcttgctttggaaattt
ttttcactggtgatagattctcctttggttcttccttctcccgaatctgtcgccgcggat
tttttttctcttgctgtggaaaaaaattttcttaaatctttagcttttactttttttaga
gttttctgcgcattttttatttcgtcttttctaggaattttatttggttttttatgcact
aaattttctgttttgaaatttttttttgaacttcctcttacgtttatccgctcggttccg
cttgtttctgtaattttgattgttcttttttggcttggctctgattctgtaccggttttt
gccgcggtgcttttgtcttttcctgttatgtttacatcggctttttcgggattttcattt
gaagacaaaaaaatggaaaacgtctgcacgatttttaaaattacagaaatgcagaaattt
ttatttttgaaaattccttatgctaaagaatttttaaaggacgcaatggaaaattcctgc
ggaatgatttggaaagctgttgccgccgcggaagttctttctgttccaaaatttgcgctt
ggaagccagcttcagaattttcaggttgttcttgaaatttcaaaagtttttgctgttaca
atttttattgttttgctcggttttttaagtgaaaaaattcttttgattttcttttttgcc
ttaaaaaaattttacaagaattttataaatttttattttcagtctgatttttttaaactg
cctcatctttctttagaaaaagaattttttgtggagttaaaaaatttttgcattgagcat
gatggaaaatttatttttaaaaattattcagaaaactttgaccagaaaaaaataacttca
attgtctcgccaagcggaagcggaaaaacaacgttgcttgattttgtgtctgaaaatttt
tcttctgtttcttattcaatgcaaactccaaatttatttttgaatcttagtgtttttcaa
aatgtgcaacttccgcttttaaatatttttggaagaaaaaaatcatttgaaataacgcag
aatattttaaataattttgggttgaatggaaaagaaaaatcttgtgtggaaaaaatttcc
ggcggagaaaggcagcgtgtttctcttgcgcgcgcggttgcttttccaagtggaattctt
ttgcttgatgaatcgtttcagtttttggatttttcagtaaaaaagaaatgcattgaattt
attttggagcgacaaaaagaaaatcctcagactgtaatttttgctgcaaacgaaataaaa
gaagcagttttgttttcagataaaataattttttattcttcatgtccaatgcttccttta
aaaacttttttagtttctgcggaagacaaaaaaaatccggctgcacttgaaaaagaaatt
cttgcgttgctttttagtttgtaa

DBGET integrated database retrieval system