KEGG   Treponema succinifaciens: Tresu_2449Help
Entry
Tresu_2449        CDS       T01461                                 

Definition
(GenBank) ribosomal protein S3
  KO
K02982  small subunit ribosomal protein S3
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tresu_2449
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tsu03011]
    Tresu_2449
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Tresu_2449
  Archaea
    Tresu_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S3_C KH_2 Macro KH_4
Motif
Other DBs
NCBI-ProteinID: AEB15311
UniProt: F2NTX9
Position
complement(2610016..2610768)
Genome map
AA seq 250 aa AA seqDB search
MGQKVNPIGLRLGVNKTWQSRWYADSREYADLFLEDMKIRKLVGSLPECKNADIAEIEIV
RHPQRVTIVIHTARPGVIIGVKGATIEKISADIQKQLTKKVQIKIKEIKRPEINASLIAQ
NVGRQLAGRGSFRKALKQSASNAMKGGAQGIKIRISGRLGGADMTRSEELKEGRVPLHTL
RADIDYGTYEALTTYGKIGIKVWVYNGMNYGREQNEDAGDIVRKPRRDRSNGDRKSARSP
KAEGGKVENA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcagaaagttaatcctatcggtttacgccttggtgtaaacaaaacttggcagtct
cgttggtatgcagattcacgtgaatatgcagacttgttcttggaagatatgaaaatccgc
aagcttgttggatctcttcctgaatgcaagaacgcagatattgctgaaattgaaattgtt
cgtcatccgcagcgtgttactattgtaattcacacagcacgcccgggtgttattattggt
gttaaaggcgctactattgaaaaaatcagcgcagatattcagaagcaactgacaaagaaa
gttcagattaagattaaggaaatcaaacgtcctgaaatcaatgcttctcttattgcgcag
aatgtaggccgtcagcttgctggccgcggttctttccgtaaggctctcaagcagtctgct
tcaaatgctatgaagggcggagctcagggtataaaaatccgtatttctggtcgtcttggc
ggagctgacatgacacgttcagaagagcttaaggaaggacgcgttcctcttcatactctt
cgtgctgacatcgattatggtacttatgaagctcttactacttatggtaagatcggcatt
aaagtatgggtctacaacggaatgaattacggacgtgagcagaatgaggatgcaggtgat
attgtaagaaagcctcgccgcgaccgctctaatggcgaccgtaagtctgctcgttcccca
aaagctgagggaggaaaagtagaaaatgcttag

DBGET integrated database retrieval system