KEGG   Treponema succinifaciens: Tresu_2450Help
Entry
Tresu_2450        CDS       T01461                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Tresu_2450
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tresu_2450
  Bacteria
    Tresu_2450
  Archaea
    Tresu_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEB15312
UniProt: F2NTY0
Position
complement(2610770..2611126)
Genome map
AA seq 118 aa AA seqDB search
MAEKKGYVATTKFLIASPTKVRPVANVVKTKSCSEAMAILDVMPQKGARLISGTLKSAVA
NALNKNKQLDEDMLYIKEIRIDEGPRLKRVWFRGRGRADQLLKRMCHITVVVDEKAGK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagaaaggttatgtagccacaactaaatttctcattgcatctcctacaaag
gttcgtcctgtagctaatgttgtaaagacaaagtcttgctctgaagctatggctattctt
gatgtaatgccgcagaaaggcgctcgtcttatcagcggaacattaaaatctgcagtagcg
aatgctctcaataagaataagcaacttgatgaagatatgctctacattaaggaaattcgt
attgacgaaggtccaagacttaaaagagtatggttccgtggacgcggacgtgctgatcag
ctcttgaagcggatgtgtcatatcactgttgtagttgacgaaaaggcgggaaaataa

DBGET integrated database retrieval system