KEGG   Treponema succinifaciens: Tresu_2451Help
Entry
Tresu_2451        CDS       T01461                                 

Definition
(GenBank) ribosomal protein S19
  KO
K02965  small subunit ribosomal protein S19
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tresu_2451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tsu03011]
    Tresu_2451
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Tresu_2451
  Archaea
    Tresu_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S19
Motif
Other DBs
NCBI-ProteinID: AEB15313
UniProt: F2NTY1
Position
complement(2611141..2611425)
Genome map
AA seq 94 aa AA seqDB search
MSRSVKKGPFIEKSLYKKVLEMNKASAADKKMIKTYSRCSTIIPEMVGNTISVHNGKSWI
PVYITENLVGHKLGEFAATRTFKGHGGSDKSAGK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaagatcagttaagaaaggaccttttatagagaaatctctttacaaaaaggtttta
gaaatgaacaaagcatcagcagctgataagaaaatgattaaaacttattcccgctgctcg
acaatcatccctgagatggtaggaaatactatttcagtgcacaacggtaagtcatggatt
cctgtgtatattacagaaaacttggtaggtcacaagcttggcgagtttgctgcaacacgc
acattcaaaggacatggcggttcagacaaatcagctggtaaataa

DBGET integrated database retrieval system