KEGG   Treponema succinifaciens: Tresu_2453Help
Entry
Tresu_2453        CDS       T01461                                 

Definition
(GenBank) Ribosomal protein L25/L23
  KO
K02892  large subunit ribosomal protein L23
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tresu_2453
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tsu03011]
    Tresu_2453
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tresu_2453
  Bacteria
    Tresu_2453
  Archaea
    Tresu_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L23
Motif
Other DBs
NCBI-ProteinID: AEB15315
UniProt: F2NTY3
Position
complement(2612294..2612578)
Genome map
AA seq 94 aa AA seqDB search
MTFNDVLIKPVLSEKATALREQNKYTFIVDPAATKFQIKEAVRKLFNVNVEDCKTINVKG
KIKRLRGRPGRTAGYKKAIVKLAAGETIKVFEGV
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgacattcaatgatgttcttattaaacctgttctttctgaaaaagcaacagcactccgt
gagcagaataaatatacttttattgttgaccctgcagctacaaagtttcagattaaagaa
gctgtacgcaagcttttcaatgtaaatgttgaagactgcaagactatcaatgtaaaaggt
aaaattaagcgtcttcgcggaagacctggaagaactgccggctacaaaaaggcaattgta
aaacttgctgctggcgaaacaatcaaggtgttcgaaggtgtttaa

DBGET integrated database retrieval system