KEGG   Treponema succinifaciens: Tresu_2455Help
Entry
Tresu_2455        CDS       T01461                                 

Definition
(GenBank) 50S ribosomal protein L3
  KO
K02906  large subunit ribosomal protein L3
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Tresu_2455
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tresu_2455
  Bacteria
    Tresu_2455
  Archaea
    Tresu_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L3 SDH_beta
Motif
Other DBs
NCBI-ProteinID: AEB15317
UniProt: F2NTY5
Position
complement(2613231..2613851)
Genome map
AA seq 206 aa AA seqDB search
MKGLIAKKVGMTQVFDENGNLTPVTVIRVEPNTVVATKTQEKCGYEAVVLGLEDLKPHKI
TKPYAKQFPENITPKRHLKEFRDFEGEVKVGDQIGVELFEKVRFIDVTATSKGKGFQGVM
KRWGFHGGRATHGSKFHREAGGTGCCTTPGHCLKNVKMPGRMGFDRVTVQNLKVVKVDPE
LNVLMVRGAVPGVRNCTLIVKAAVKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtctgatagcaaaaaaagtaggaatgacacaggttttcgatgaaaacggcaat
ctgacaccagtaaccgtgatccgcgtcgagccaaacactgttgttgctacaaagacacag
gaaaagtgcggctatgaagctgttgtccttggacttgaggatttgaagcctcacaagatt
acaaagccatacgcaaagcagtttccagagaacattacaccaaaacgtcatcttaaagaa
ttcagagactttgaaggtgaagttaaagttggcgaccagattggtgtagaattgtttgaa
aaggttcgtttcatcgacgtaactgctacctcaaaaggtaaaggttttcagggtgtaatg
aagagatggggcttccatggtggacgtgctacacacggttcaaaattccatcgtgaagct
ggcggcactggatgctgtacaactccgggacattgtcttaaaaatgttaagatgcctggc
cgcatggggtttgatcgcgttacagtacaaaacctcaaggttgtgaaagttgaccctgag
ctcaatgttttgatggttcgtggtgcagttcctggtgtaagaaactgtactcttatcgtt
aaggctgcggttaagaaataa

DBGET integrated database retrieval system