KEGG   Treponema succinifaciens: Tresu_2457Help
Entry
Tresu_2457        CDS       T01461                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tsu03012]
    Tresu_2457
   03029 Mitochondrial biogenesis [BR:tsu03029]
    Tresu_2457
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tsu04147]
    Tresu_2457
Translation factors [BR:tsu03012]
 Eukaryotic Type
  Elongation factors
   Tresu_2457
 Prokaryotic Type
   Tresu_2457
Mitochondrial biogenesis [BR:tsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Tresu_2457
Exosome [BR:tsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tresu_2457
  Exosomal proteins of breast cancer cells
   Tresu_2457
  Exosomal proteins of colorectal cancer cells
   Tresu_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AEB15319
UniProt: F2NTY7
Position
complement(2614289..2615476)
Genome map
AA seq 395 aa AA seqDB search
MAKEEFNRTKPHMNVGTIGHVDHGKTTLSAAITAYCAKKYGDKLLKYDEIDNAPEEKARG
ITINSRHLEYQSDKRHYAHIDCPGHADYIKNMITGAAQMDGAILVVSAPDSVMPQTKEHL
LLARQVGVPKIIVFLNKVDLVDDPDLLMLVVDEVKETLKGYGFSEDTPIIQGSAFKALNE
SDNPENTKCIEELLTAMDTWFDDPVRDDQKPFLMPIEDIFTITGRGTVVTGRIERGVIHM
GDAVEIVGIRPTQSSTVTGIEMFNKTLNEGMAGDNAGILLRGVEKKDVIRGQVLAAPGSI
HPHTKFEAQIYVLSKEEGGRHSPFFTGYRPQFYFRTTDITGTVELEPGTDMVKPGDNVKI
IGELIHPIAMDEGLKLAIREGGRTIASGQVTKIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaagagttcaacagaactaaacctcacatgaacgttggtactatcggtcac
gttgaccatggtaagactacactttctgctgctatcactgcttattgtgcaaaaaaatac
ggtgataagctcttgaagtacgatgaaatcgacaatgcgccggaggaaaaggctcgtggt
atcactatcaacagccgccaccttgagtatcagtctgacaagcgtcactatgcacatatt
gactgcccgggacatgctgactacatcaagaatatgattactggtgctgctcagatggat
ggagctattctcgttgtttctgctccagattcagttatgccacagacaaaagagcacctt
cttcttgctcgtcaggttggcgtaccaaagattatcgtattccttaacaaggtcgacctt
gttgacgatccagatcttcttatgctcgttgttgacgaagtaaaagaaactctcaaaggc
tacggcttctctgaggatacaccaattatccagggatctgcattcaaggctttgaacgaa
tctgacaatccagaaaatacaaaatgcatcgaagagcttcttacagctatggacacatgg
tttgatgatccagttcgtgatgaccagaagccattcttgatgccaattgaagacatcttc
acaatcacaggacgtggtactgttgttactggacgtatcgagcgcggtgttatccatatg
ggtgacgctgttgaaatcgttggtatccgcccaactcagtcttctactgtaactggaatc
gaaatgttcaacaagactcttaacgaaggtatggctggtgacaatgctggtattcttctt
cgtggtgttgaaaagaaagatgttatccgtggacaggttcttgctgctccaggaagcatc
cacccgcacacaaagttcgaggctcagatctacgttctttcaaaggaagaaggtggacgc
cacagcccgttcttcacaggttaccgcccacagttctacttcagaacaacagacattact
ggtactgttgagctcgaaccaggaacagatatggtaaaacctggcgacaacgttaagatt
atcggtgaacttattcacccaatcgctatggatgaaggtcttaagcttgctatccgtgaa
ggtggacgcacaatcgcttctggacaggtaacaaagattatcgaatag

DBGET integrated database retrieval system