KEGG   Treponema succinifaciens: Tresu_2458Help
Entry
Tresu_2458        CDS       T01461                                 

Definition
(GenBank) ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tresu_2458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tsu03011]
    Tresu_2458
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Tresu_2458
  Bacteria
    Tresu_2458
  Archaea
    Tresu_2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7 Phage_TAC_12 IL5
Motif
Other DBs
NCBI-ProteinID: AEB15320
UniProt: F2NTY8
Position
complement(2616199..2616669)
Genome map
AA seq 156 aa AA seqDB search
MGRHKKSVNRPVMPDERYNSVVISKFVTRMMLDGKKQVCQKIVYEALDKLKKKTDKDPLE
VFLKALENLKPMVEVKSRRVGGATYQVPIEIRDARREALGMRWMINAARSRNGHGMAETL
AAEIFDAFNNTGSAYKKKEDTHKMAEANKAFAHYRW
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggaagacataagaaatcagttaaccgtccggttatgccagacgaaagatacaacagc
gtagttatttcaaaatttgtaacacgcatgatgcttgatggaaaaaagcaggtttgccag
aaaatcgtttatgaggctttggacaaattgaagaaaaaaactgacaaggatcctcttgaa
gtgttccttaaggctttggaaaatttaaagccaatggtggaagtaaaaagccgccgtgtt
ggtggagctacatatcaggttcctattgagattcgtgatgcacgccgcgaagctcttgga
atgagatggatgattaatgctgcccgttcacgtaacggacacggaatggctgaaactctt
gctgctgaaatctttgatgctttcaacaacacaggttctgcttataagaagaaggaagat
acacacaagatggcagaggcaaacaaggcttttgctcattaccgctggtag

DBGET integrated database retrieval system