KEGG   Treponema succinifaciens: Tresu_2460Help
Entry
Tresu_2460        CDS       T01461                                 

Definition
(GenBank) DNA-directed RNA polymerase subunit beta'
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00230  Purine metabolism
tsu00240  Pyrimidine metabolism
tsu01100  Metabolic pathways
tsu03020  RNA polymerase
Module
tsu_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tresu_2460
   00240 Pyrimidine metabolism
    Tresu_2460
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    Tresu_2460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tsu03021]
    Tresu_2460
   03400 DNA repair and recombination proteins [BR:tsu03400]
    Tresu_2460
Enzymes [BR:tsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Tresu_2460
Transcription machinery [BR:tsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     Tresu_2460
DNA repair and recombination proteins [BR:tsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      Tresu_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_4 RNA_pol_Rpb1_3 Peptidase_M23 Apocytochr_F_C Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEB15322
UniProt: F2NTZ0
Position
complement(2617208..2621692)
Genome map
AA seq 1494 aa AA seqDB search
MRDIQDFTSLKIKLASPENIRSWSYGEVKKPETINYRTLRPERDGLFCERIFGTTKEWEC
YCGKFKSIRYKGVVCDRCGVEVTHFKVRRERTGHIDLAAPVSHIWYYHSVPSRMGLLLDL
QVAALRSILYYEKYIVIEPGDTDLKKNQLLTEDEYLEAQERYGGAFTAGMGAEAIKTLLE
NLDLDALAAELRAKMIEKGPKSDKRLLKRIEIVENFRTSENKASWMILDVIPVIPPDLRP
MVQLDGGRFATSDLNDLYRRVINRNNRLKKLQSLSAPDIIIRNEKRMLQEAVDSLFDNSK
RKQRVLKGAANRPLKSISDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLWQCGLPE
KMALELFKPFIMKKLVDKGVVFNIKKARSLVESESTEVFAILDEVVREHPVMLNRAPTLH
RLGIQAFEPVLVPGKALKLHPFACKAFNADFDGDQMAIHVPLTQAAQMECWTLMLSARNL
LDPANGNTIVAPSQDMVLGIYYMTSIKPNAKGTGKFFSSADEVRLAASSGAIEWQAEIKV
HKNILNKCVNNDKEPDSKYILTSAGRMAFNESMPDEVDFYNEQLGDKKLKKMIESVYHNE
QTSDKRIKGLIEEKYQFETFDAETLDKVIEDASLRKQIDKIYNRETPLEEYKLRKILPSL
YAIDRGWLTIQMLDAIKACGYKNATFYGATLSMDDILVPEEKEAMVAEANKEVEKIVGQW
NSGAITADERYNKSVTVWENTNEKLTNLMMDNLAKHKDGFNTIYMMATSGARGSKKQISQ
LAAMRGLMQKPNGDIIELPIRANFKEGLSVIEFFISTNGARKGLSDTALKTADAGYMTRR
LVDVAQDVVVNEEDCGTINGIDYAAIKDGDTVTVPLAKRIAGHYTIERVIDPVSGELLCD
VNQYIDETLAEKIDKAGVEKVKLRTVLTCESKHGICVKCYGKDLARNKIVEIGEAVGTIA
AQSIGQPGTQLTLRTFHTGGAAEGGQKDNHIAMKYDVYIKSLEGTHVVAKNGNWLFTRRG
SMIVTKLFKSYAFDSSDEVLVEDGAYVRKDNPVLKHKGQEVLASDGGRIIIRDNVIYLTS
NDQKVEISNGSTVYAKFTEASCIAKAGEPVGEFDPYSEPIIAEVSGYIHYEDIIDGVTLE
TKTDIQTGAVERRISDLHLDVKQPRIIITDEDGNELGSYHMPVGAILSNDIKDKGKVEAG
TTLAKMAKDAAKANDITLGLPRVSELFEARKPKNPAVIAKITGTVKFDKIVKGKRTVIVV
DEYGKEHSHLIPMVKRLLVRDGDKVEAGEKLCDGAVDAHDVLSVLGEDRLQNFLMDEIQS
VYRAQGVDINDKHIGTIIRQMLKKVEIIKVGDTRFIYGQQVDKYTFREENDRVVAEGGQP
AVACPMFQGITKAALAADSFISACSFQETTRVLTNAAIAGSVDNLHGLKENIIIGHRIPA
GTGIRQYNNVKLSDNSNADLDAKMKEILEQRMLEMKEAEEAAVVPAMDSASDED
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacattcaggatttcacaagccttaaaattaaacttgcttccccggaaaatatc
cgttcatggtcttacggtgaagtaaaaaagccggaaactataaattaccgaactcttcgt
ccggagagggacggacttttctgcgagcgcatctttggtacaacaaaagaatgggaatgc
tactgcggaaaattcaagtcaatccgctataaaggtgttgtctgtgaccgctgtggagtt
gaagttacacactttaaagtccgccgtgagcgcactggacacattgatttggcggctcct
gtcagccatatttggtattatcattcggttcctagccgcatgggacttttgcttgatttg
caggtggctgctctccgctcaattctttactatgaaaaatacattgtaattgagccgggc
gacacagatttaaagaaaaatcagcttttgacagaagatgaatatcttgaagcgcaggaa
cgctatggcggcgcatttacagcgggaatgggagcagaggcaattaagactttgcttgaa
aatcttgaccttgatgctcttgctgctgagcttcgtgcaaaaatgattgaaaaaggtcca
aagagcgacaagcgtcttttgaagagaattgaaattgtggaaaatttccgcacttcagaa
aacaaggcttcttggatgattctggatgttattccagttattccgccggatttgcgccct
atggttcaacttgacggaggacgctttgcaacttccgacttgaacgacctttaccgccgc
gtaattaaccgcaacaaccgtttaaagaagcttcagtctttgtctgcgcctgatattatt
attcgcaacgaaaaacgtatgcttcaggaagcagttgactcattgtttgataactctaag
cgcaaacagcgtgttttaaaaggtgccgcgaaccgcccgcttaaatcaatcagcgatatg
cttaaaggaaagcagggacgtttccgtcagaatttgcttggaaaacgcgttgactattct
ggacgttctgtaattgttgttggacctgaacttaagctttggcagtgcggtcttcctgaa
aaaatggcgttggaactcttcaagccgtttataatgaagaaacttgttgacaagggtgtt
gtcttcaatattaaaaaggctcgctcacttgtagaaagcgaatccacagaagtttttgca
atccttgatgaagttgtccgcgagcatcctgtaatgcttaaccgcgctcctactttgcac
cgcttgggaattcaggcatttgagccggttcttgttccaggaaaggcattgaagcttcat
ccttttgcttgtaaagcatttaacgccgacttcgatggcgaccagatggcaatccacgtg
cctcttactcaggcagctcaaatggaatgctggacacttatgctttctgcacgcaacctt
cttgacccggcaaacggaaacacaattgtagctccttctcaggacatggttttgggaatt
tactacatgacttctataaagccgaatgcaaaaggtacaggaaaattcttctctagtgcg
gatgaagttcgtcttgcggcttctagcggagcaattgaatggcaggcagaaatcaaggtt
cacaagaatattctcaacaagtgcgtaaacaacgacaaagagccagacagcaagtacatt
cttacatctgccggacgcatggctttcaatgagtcaatgccggacgaagttgacttctac
aacgagcagcttggtgacaaaaagctcaagaaaatgattgaaagtgtttaccacaatgag
cagacaagcgacaaacgcataaagggccttattgaagaaaaatatcagtttgaaactttt
gatgcggaaacattggacaaagttattgaagatgcttcccttagaaagcagattgacaaa
atctacaatagagaaactccgcttgaagagtacaaactcagaaaaattcttccgagcctc
tatgcaattgaccgtggatggcttacaatccagatgcttgatgcaatcaaagcctgtgga
tacaaaaacgctacattctacggcgcaactctttcaatggacgatattcttgttccagaa
gaaaaagaagctatggttgcagaagcaaacaaggaagttgaaaaaattgtaggtcagtgg
aacagcggtgctattacagctgacgaacgctacaataagtctgttacagtttgggaaaac
acaaacgaaaagcttacaaaccttatgatggataaccttgcaaagcacaaggacggattt
aatactatctatatgatggctacatccggcgctcgtggttccaaaaagcagatttcccag
ctggcggcaatgcgtggacttatgcagaagcctaacggagacatcattgagcttccaatc
cgcgcgaactttaaggaaggactttcagttattgagttctttatttcaacaaacggtgcg
cgcaaaggtttgtctgatacagctttgaagactgctgatgctggttacatgacacgccgt
cttgtagatgttgctcaggatgttgttgtaaatgaagaagactgcggaacaatcaacgga
attgactacgctgcaatcaaggacggagatactgttacagttcctttggcaaaacgcatt
gcgggacattatacaatcgaacgggtaatcgaccctgtttctggtgagcttctttgtgat
gtaaaccaatatatagatgaaacccttgctgaaaaaatcgacaaggctggagttgaaaaa
gttaagctgcgcacagttcttacttgcgaaagcaaacacggaatttgtgtaaaatgctac
ggaaaagaccttgcccgcaacaagattgttgaaatcggtgaagcagttggaactattgcg
gcccagtcaattggtcagcctggtacacagcttacacttcgtacattccatactggtggt
gctgcggaaggtggacagaaagacaaccacatcgcaatgaaatacgatgtttacatcaaa
agccttgagggaacccatgttgttgcaaaaaatggaaactggctctttacacgccgtggc
tcaatgattgttacaaagctgttcaagtcttatgcttttgattcttctgatgaagttctt
gttgaagacggcgcttatgtccgcaaggataatccggttttgaagcacaaaggacaggaa
gttcttgcttctgacggcggccgcattatcataagagataatgtaatttaccttacaagc
aatgaccagaaagttgaaatttccaacggttcgactgtatatgcaaaattcacagaagct
tcatgcattgcaaaggctggcgagcctgtgggtgaattcgatccttatagcgagccgatt
attgcggaagtttccggctacattcattatgaagatattattgacggcgtaactcttgaa
acaaaaactgatattcagactggagctgttgaacgccgcatttcagatcttcaccttgat
gtaaagcagcctcgtattattattacggatgaagacggaaacgagcttggaagctaccat
atgcctgttggtgctattttgagcaacgacatcaaggacaagggaaaggtcgaagctgga
acaactcttgcaaaaatggcaaaagatgctgcaaaggcgaacgatattactcttggtctt
ccgcgtgtttccgagctttttgaagcgcgcaagccaaagaatcctgctgtaatagcaaag
attactggaactgtgaaattcgataagattgtaaaaggaaaaagaactgttatcgttgtt
gacgagtacggaaaagagcacagccatcttattcctatggttaagcgtcttcttgtccgc
gatggcgataaagttgaagccggagaaaagctttgcgatggagcagtagatgcacatgat
gttctttctgttcttggcgaagaccgtcttcagaacttccttatggatgaaattcagtct
gtttaccgtgctcaaggcgtagatattaacgacaagcacatcggaactattatccgccag
atgctcaagaaagttgaaatcatcaaagtcggggacacaagattcatctacggtcagcag
gttgacaagtacacattccgcgaagaaaacgacagagttgttgcggaaggtggacagcca
gccgttgcctgtcctatgttccagggaattacaaaagctgctcttgccgctgattcgttt
atttcggcttgttcattccaggaaacgactcgtgttcttacaaatgccgcgattgcaggt
tctgtagacaatcttcacggtcttaaggaaaatattattattggacacagaattcccgct
ggtacaggaatccgccagtacaataatgtaaagctttcagacaattcaaacgccgacttg
gatgccaagatgaaggaaattcttgagcagcgtatgcttgaaatgaaggaggctgaagaa
gctgctgttgttccagcaatggattctgcttcggacgaggattaa

DBGET integrated database retrieval system