KEGG   Treponema succinifaciens: Tresu_2464Help
Entry
Tresu_2464        CDS       T01461                                 

Definition
(GenBank) ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Tresu_2464
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tresu_2464
  Bacteria
    Tresu_2464
  Archaea
    Tresu_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1
Motif
Other DBs
NCBI-ProteinID: AEB15326
UniProt: F2NTZ4
Position
complement(2626623..2627300)
Genome map
AA seq 225 aa AA seqDB search
MKHGKKYRESLKKYDPAKAYGISEACQLVKDLHYVKFDETVELSVSLKLEKNQTVRDTLV
FPHQFTAEKRVLVFCKDDRVKEALDAGATYAGTEYIEKVKGGWLDFDVAVATPDMMKDVG
RLGMVLGRKGLMPNPKTGTVTPNIAQAVAELKKGRTEFRADKTGVVHIPVGKVSMDSKDT
AENVKVFLTELERKKPADAKVGFVRSVSISSSMGPGVWIDFKEAE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacggaaagaaataccgcgaatcattgaagaagtatgatccggcaaaggcttat
ggaatttcagaagcttgccagcttgtaaaagatcttcactatgtaaagttcgatgagaca
gttgagctttcagtttcccttaagctggaaaaaaaccagactgtacgtgatactcttgta
ttcccgcatcagtttactgctgaaaagcgcgttcttgttttctgtaaagatgaccgtgta
aaagaagctcttgatgcaggtgcaacttacgcaggtacagagtacattgaaaaagtaaag
ggcggatggcttgattttgatgttgcagttgctactccagacatgatgaaagacgttggt
cgtcttggtatggttttgggacgcaaaggtcttatgccaaaccctaagacaggaactgta
acaccaaacattgcgcaggctgttgctgagctcaaaaagggacgcacagaattccgcgca
gacaagacaggtgttgttcatattcctgttggaaaagtttccatggattcaaaggacact
gctgaaaacgtaaaagttttcctcacagaacttgagcgcaaaaagccggctgatgcaaaa
gtaggatttgtacgctctgtttcaatcagctcttcaatgggacctggtgtttggattgac
tttaaggaggcagaataa

DBGET integrated database retrieval system