KEGG   Treponema succinifaciens: Tresu_2465Help
Entry
Tresu_2465        CDS       T01461                                 

Definition
(GenBank) ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tresu_2465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tsu03011]
    Tresu_2465
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tresu_2465
  Bacteria
    Tresu_2465
  Archaea
    Tresu_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Motif
Other DBs
NCBI-ProteinID: AEB15327
UniProt: F2NTZ5
Position
complement(2627300..2627734)
Genome map
AA seq 144 aa AA seqDB search
MATKKVTAVIKLQCPAGAATPAPPIGPALGPHGVSAPKFVQEFNDRTKSMEKGLIIPVVI
TVYQDKSYTFILKTPPAAVLIKKAVGIQKGSGNPLRNKVGKLSKASLEEIAKQKLPDLNA
NDIEAAKKIIAGTARSMGVEVEAE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaaaaaggttacagctgtcattaaacttcagtgccctgccggcgctgctaca
ccagctccacctattggaccggctcttggacctcatggagtttctgcgcctaagttcgtt
caggaattcaatgaccgcacaaagagcatggagaagggacttattatccctgtagtcatc
actgtctatcaggacaaatcttacacatttattctcaagactcctcctgcagctgttctt
attaaaaaggctgttggaatccagaaaggttctggaaatccgcttcgcaacaaagttgga
aaactttcaaaagcgtcccttgaagaaattgcaaaacagaaacttcctgatcttaacgca
aacgacattgaggctgctaagaaaatcatcgctggtactgctcgcagtatgggcgtagaa
gtggaggctgaataa

DBGET integrated database retrieval system