KEGG   Treponema succinifaciens: Tresu_2469Help
Entry
Tresu_2469        CDS       T01461                                 

Definition
(GenBank) Serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00270  Cysteine and methionine metabolism
tsu00920  Sulfur metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01200  Carbon metabolism
tsu01230  Biosynthesis of amino acids
Module
tsu_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tresu_2469
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tresu_2469
Enzymes [BR:tsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     Tresu_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 SATase_N
Motif
Other DBs
NCBI-ProteinID: AEB15331
UniProt: F2NTZ9
Position
complement(2629214..2630077)
Genome map
AA seq 287 aa AA seqDB search
MSATIDTAVEKILESYQKYGGINLDEAMKFPNRENVITVLKDIQCLIFPGYRVAEEIDSL
TLRFVTGERVNRIVSMLTREIKKALSFVVQNDKVELSHCFNLAEKASLALIEEIPEIRRK
IGLDVQAANAGDPAAKSSEEVIVSYPCLEAISVYRIAHFLTENGVPVIPRIMSEYAHSHT
GIDINPGAKIGESFFIDHGTGVVIGESCIIGNNVKIYQGVTLGALSVKKELMNKKRHPTI
EDNVTIYANATILGGNTVIGEGCVIGGNTWITKSVPPHTTFTQECRS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgacaattgacactgccgtagaaaaaatacttgagtcttaccaaaagtacgga
ggaatcaaccttgatgaagccatgaagtttccaaacagggaaaatgtcataacggttcta
aaggacattcagtgcttgatttttccaggctacagggttgcggaagaaattgattcgctt
acattgaggtttgttacaggcgagcgtgtgaaccgcatagtttcaatgcttacccgcgaa
attaaaaaagccctttcttttgttgtccagaacgacaaagtggagctttctcactgtttt
aaccttgcggaaaaggcttctctcgcgcttattgaggaaattccagaaatccgcagaaaa
atcgggcttgatgttcaggctgccaatgctggagatccggctgcaaagtccagtgaggaa
gtaatagtttcgtatccgtgccttgaagcgatttcagtttataggattgcgcattttctt
actgaaaacggagttcctgttattccgcgcataatgagcgagtacgcgcacagccatact
ggaattgatataaatccgggtgccaaaataggcgaaagtttttttattgaccatggaact
ggtgttgtaatcggcgaaagctgcattatcggcaacaatgtaaagatttaccaaggcgtt
acgctgggagctttgagcgtaaaaaaggagcttatgaacaaaaaacgccacccaacaata
gaagacaacgttacaatttacgccaatgccacgattctaggcggaaacaccgtcattgga
gaaggctgcgtaataggcggaaatacttggattacaaagtctgttcctccgcatacaacc
tttacgcaggaatgccgctcgtaa

DBGET integrated database retrieval system