KEGG   Treponema succinifaciens: Tresu_2472Help
Entry
Tresu_2472        CDS       T01461                                 

Definition
(GenBank) protein of unknown function DUF497
  KO
K09803  uncharacterized protein
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Tresu_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BrnT_toxin
Motif
Other DBs
NCBI-ProteinID: AEB15334
UniProt: F2NU02
Position
complement(2630986..2631306)
Genome map
AA seq 106 aa AA seqDB search
MLKGELEIDGLFEWWSDKNEANIKKHHYSFKEVEKIFNDPYFYEIYDIEHSDEEQARYFG
LGIIEEKCLVLQVSYTEEERIHIITARDATPKEREVYFERLRRAYC
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaaggtgagttggaaattgatggtctctttgagtggtggtcagataaaaatgaa
gcaaacataaaaaagcatcattattcattcaaagaagttgaaaaaatttttaacgatcct
tatttttatgaaatttatgatattgagcattcagatgaggagcaagctagatattttggt
cttggaattattgaggaaaaatgccttgtgctacaagtaagctacacagaagaagagcgc
attcatataataactgctcgtgatgcaacgccaaaagagcgggaggtgtactttgaaaga
cttagaagagcttattgctaa

DBGET integrated database retrieval system