KEGG   Treponema succinifaciens: Tresu_2474Help
Entry
Tresu_2474        CDS       T01461                                 

Definition
(GenBank) Sulphatase-modifying factor protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Flg_new
Motif
Other DBs
NCBI-ProteinID: AEB15336
UniProt: F2NU04
Position
complement(2633121..2634068)
Genome map
AA seq 315 aa AA seqDB search
MSGLGNSEVTVVAGETSPCTVTLHDKFTVTFDSNGGTGTMSSQVFTYGTSQSLSENLFTK
DGFIFQSWATSIDSDPVYNNASINVFEKTDVTLYAKWSTDGFVFVEGATIAEAAPNSKIF
DGSESKTIGNFYICDHEVTQAEYSKYGGATSSGGGDYPAYNVSWTAALKYCNARSEAEGL
TPCYVVNGNNSTCNFEANGYRLPTEVEWEYAARGGNGLTGTQYMYSGSDTLADVGWCDNT
IYETKKLSPNILGMYDMSGNVEEWCWDSNDSGKRCVRGGSSKMVNSTMCTVYYHLYMLYT
DGSNRNGFRIVRTVK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgtctggtcttggaaattcagaagtaacagttgttgctggagaaacttctccttgcact
gtaacgcttcatgacaaatttactgtaacttttgattcgaatggcggaactggaacaatg
tcttctcaagtttttacttacggaacttctcagtctctttcagaaaatttattcacaaaa
gacggctttatatttcaaagctgggcgactagcatagacagcgacccggtttacaataat
gcttctattaatgtatttgaaaaaacagatgttacactttatgcaaaatggtctacggat
ggatttgtatttgtagaaggggcgacaatagcagaagccgctccaaatagcaaaattttt
gatggtagtgaatcaaaaactattggcaacttttatatttgtgaccatgaagttacgcag
gcagagtacagtaagtatggaggagctacctcctctggaggtggagattatcctgcatat
aatgtgagttggacagcggcattgaaatattgcaatgcccgaagtgaagccgaaggacta
acgccttgttatgtcgtaaatggaaataattcaacttgtaattttgaagcaaatggctat
cgattgcctacagaagttgaatgggaatatgcggcacgcggcggaaacggattgaccggt
acgcagtatatgtattcaggaagtgatactttggctgatgttggatggtgcgacaatact
atctatgaaacaaaaaaactatcaccaaatatacttggtatgtatgatatgagtggaaat
gtagaagaatggtgctgggattcgaatgattctggaaaaagatgtgttagaggcggtagt
tctaaaatggttaattcaactatgtgtacagtttattatcacttatatatgctctatact
gatggttcaaatagaaacggtttccgcatagttcgtactgtaaaataa

DBGET integrated database retrieval system