KEGG   Treponema succinifaciens: Tresu_2476Help
Entry
Tresu_2476        CDS       T01461                                 

Definition
(GenBank) polysaccharide deacetylase
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AEB15338
UniProt: F2NU06
Position
complement(2634599..2635210)
Genome map
AA seq 203 aa AA seqDB search
MKYITLSFDDGPNANVMSDMLDVLEFNRIPASFFLVGNKINEDSAKVVRRAFKMGCDIQN
HSFTHSDMSKMSIAMIQDEYEKTESLIEKCIGKRSEFFRPPYISVSGNMHKAIKVPFVGG
KGCEDWLPEITAEQRAERILKSAEDGQIVLLHVMEENYATVQAVKSVIPVLKSRGYEFVN
LPELFRIKNINPCIPSHIWTTVK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatataacgctttcgtttgatgacggacctaatgcaaatgttatgtcagacatg
ctagatgttcttgaatttaataggattccggcgtcattttttttagtcggaaacaaaatc
aatgaagactctgcaaaagttgtaaggcgcgcatttaaaatgggatgcgacattcaaaat
cattcatttacgcattccgatatgtcaaaaatgagcattgccatgattcaggacgaatat
gaaaaaactgaatctcttatagaaaagtgcatcggcaaaagaagcgaatttttccgtccg
ccttatatcagcgtaagcggcaatatgcacaaggctataaaagttccttttgttggcgga
aaaggttgcgaggactggcttcctgaaattactgctgaacaaagagctgagcgtatttta
aaatctgcggaagatggacagatcgtacttcttcacgtaatggaagaaaattatgcgaca
gttcaggctgtaaagtctgttattccagttttaaaatcccgcggctatgaatttgtaaac
ctgccagaactttttaggataaagaatataaatccttgtattccatcacatatttggaca
acagtaaaatag

DBGET integrated database retrieval system