KEGG   Treponema succinifaciens: Tresu_2478Help
Entry
Tresu_2478        CDS       T01461                                 

Definition
(GenBank) hypothetical protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB15340
UniProt: F2NWM1
Position
complement(2636198..2636917)
Genome map
AA seq 239 aa AA seqDB search
MKKNIFFACLIFSFVCFAKAPYFNLDAENVFVLDANSIDGKAREDVKLINETEEQIGFEV
YYYDNKNASWQFYGSTYLKDFYDSEDVDSHMEYRISQIQYFAVVPTNNKAYNYRAQKIEN
DLCIFVMPDSEFDFKKELETAFIIDSDNIKDKFYDEIEFVNFTDDYGISFAVYASDNNKD
WKRAGGVTLQEYNDSEDLDSPIEKTLHSFRYFAIVSKNGKKYNFEARKQKGDLVIFVRN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatattttttttgcctgcctgatttttagttttgtttgttttgctaaggct
ccttattttaaccttgatgctgaaaatgtgtttgttcttgatgccaactctatagatgga
aaagcaagggaagatgtaaagctcataaacgaaacagaagagcaaattggctttgaagtt
tattattatgataacaaaaatgcctcatggcagttttatggaagcacatacttaaaagat
ttttatgattcagaagatgttgactcccacatggaataccgtatttctcaaattcagtat
tttgcagtagttcctacaaataacaaggcttacaactatcgtgcgcagaaaattgagaat
gacctttgcatttttgtaatgccagattccgaatttgattttaaaaaggaacttgaaacc
gcctttataattgattcagacaatataaaagataagttttatgacgaaatagagtttgta
aactttactgacgactatggaatttcttttgcggtttatgcttctgataataataaagac
tggaaaagagccggcggtgttactctgcaagaatataatgattcagaagacttggattct
cccattgaaaaaacacttcacagttttaggtattttgcaatcgtttcaaaaaatggaaaa
aaatataattttgaagcaagaaaacaaaaaggcgaccttgttatatttgtaagaaattag

DBGET integrated database retrieval system