KEGG   Treponema succinifaciens: Tresu_2483Help
Entry
Tresu_2483        CDS       T01461                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00340  Histidine metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Tresu_2483
Enzymes [BR:tsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Tresu_2483
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Tresu_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth PRA-CH PRA-PH NanE PcrB
Motif
Other DBs
NCBI-ProteinID: AEB15345
UniProt: F2NWM6
Position
complement(2641221..2642516)
Genome map
AA seq 431 aa AA seqDB search
MVISSIDLKGGHVVQLKNGKDLVLQRDDADSLISEFNKYGEVAVIDLDAALGNTDEKGNT
ANTDLLKSLLRRGNVRVGGGIRTVKKARELVSLGAEKVIIGSAAWNLDRKNGGSILNTEF
LDELASSIGKQRIIISVDAINGKIAVKGWTETADISLIEGAHEAEKYASELLFTCVEKEG
CMQGTDMDMVKQLRGSVKCRVVAAGGVNSLEQIVQLEKLHCDVQLGMALYTGAVNLKESF
ISCIDWEKTNGMVPIIAQSPAGEVLMMGYSNKEALEKTFELGKLTFFSRTRNTLWTKGET
SEHFLELVKMRADCDRDTILATVIPHGGVCHTGSFNCFSSEADEKSSMERLYGTIAERFA
NPRPGSYTATLNDKRVREKILEEAEELTEAEGKDEVIWEAADLLYFASVLMYKEGVTWQD
VYNELDRRHKK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggtaatttcttctatagatttaaagggcggtcatgttgttcagctgaaaaacggaaaa
gaccttgttcttcagcgtgatgatgccgactcattgatttcagaattcaataaatatggc
gaagtcgcagttatagatttggatgcggctttgggaaatactgatgaaaaaggaaacact
gcgaacacggatcttttaaagtctcttttgcgcagaggaaatgtccgggttggcggcgga
atcagaactgtaaagaaagcccgagagcttgtttcgcttggagctgaaaaagttataatt
ggctctgcggcttggaatcttgatagaaaaaacggcggctcaattcttaacacagaattc
cttgacgagcttgcctcttcaattggaaaacagcgcattataatttccgtggatgcaata
aacggaaaaattgcagtaaaaggctggacagaaaccgcggacatttctttgattgaaggt
gcgcatgaagccgaaaaatacgcatccgaacttttgtttacttgcgttgaaaaagaaggc
tgtatgcagggaacggatatggatatggtaaagcagctccgtggttctgtaaaatgccgt
gttgttgctgccggcggagtaaattctcttgagcagattgttcagcttgaaaaacttcat
tgcgatgttcagcttggaatggctttgtatactggagctgtaaatcttaaagaaagcttt
ataagctgcattgactgggaaaagacaaacggaatggttccgatcattgcccaaagtccg
gctggcgaagttcttatgatgggctattcaaataaggaagctttggaaaaaacttttgag
cttggaaaacttactttctttagccgcacaagaaacactctttggacaaaaggtgaaact
tccgagcatttccttgagcttgtaaaaatgagagctgactgcgaccgggacacaattctt
gcgactgttattccgcatggaggagtttgccacacaggaagctttaactgtttttctagc
gaggctgatgaaaaaagcagcatggagcgtctttacggaacaattgcagaacgctttgca
aatccgcgtccgggaagctacactgcgactttaaatgacaagcgagtccgtgaaaaaatc
ctggaagaagcagaggagcttacagaagctgaaggaaaagacgaagtaatctgggaagct
gcagacttgctttattttgcgagtgtcctaatgtacaaggaaggcgtaacttggcaggat
gtttacaacgagcttgacagaagacataaaaaataa

DBGET integrated database retrieval system