KEGG   Treponema succinifaciens: Tresu_2488Help
Entry
Tresu_2488        CDS       T01461                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_5 Fer4 Fer4_7 Fer4_9 Fer4_6 Fer4_16 Fer4_21 Fer4_10 Fer4_2 Fer4_18 Fer4_22 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AEB15350
UniProt: F2NWN1
Position
complement(2649177..2650340)
Genome map
AA seq 387 aa AA seqDB search
MIVSVILCGLMSIVILFFVIANNGFSAVSIFYGLFLMFIYGGMTFSENKKKGSGTIYRRI
FLTTYAVFFCIGFIANLFAERGSMAITNEALATCELPFCHIVIPQGLLSYLATQTVIFPA
RVSGHFASIASMLGIWLVFTLVLGRGWCAWVCFYGGWDEGFSHIAKKRRLNLLAHNKEIR
EFQFGFLFFLVLACFGTMSALYCDWFCPYKIVTEFFPMTTIPGLIAGIIFIGLFLGLVVV
LPILTKRRTQCSMLCPFGAFASLTDKLSPFKMRIDTEKCKGCMKCAQACLFGAIDVATIQ
QKKNSPEITCAKCGECVAVCPEKAISYQFRFNKGCCAPVPKTKLAKGIQKFFAPENLFRF
AAFTFGAIMSSAFTINSIEIILKFFAH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttcagttattctttgcggcttgatgtcgattgtcattttgttttttgtaatt
gccaacaacggattttccgcagtatctattttttatggtttgttccttatgtttatttac
ggcggaatgactttttcagaaaacaaaaagaaaggaagcggaaccatataccgcagaatt
tttttgacaacttatgctgtgtttttttgcattggatttattgcgaatctttttgcagaa
aggggaagcatggcaattaccaacgaggctcttgcaacttgcgagcttccgttttgtcat
attgtaattccgcagggacttttgtcttatcttgcaacgcaaactgtgatttttcctgca
agagtttcagggcattttgcttcaattgcgagtatgcttggtatatggcttgtgttcact
cttgttcttgggcgcggctggtgtgcctgggtttgtttttacggtggctgggatgaaggt
ttttcgcacattgcaaaaaaaaggcggcttaatcttttggctcataacaaggaaatccga
gagtttcagtttggatttttgttctttttggttcttgcctgttttggaactatgtcggct
ctttattgcgactggttctgcccgtataaaattgtgacggaattttttcctatgacgaca
attcctggacttattgcgggaattatttttatagggcttttcttggggcttgtagttgtg
cttccgattttgactaagcgcaggacacagtgcagtatgctttgtccatttggtgcattt
gcttctttgactgacaaactaagtccattcaaaatgcgcattgacactgaaaaatgcaaa
ggctgcatgaaatgtgcgcaggcttgtctgtttggagcaatcgatgttgcaacaattcag
cagaaaaaaaattcgccggaaattacttgtgcaaaatgcggagaatgcgttgcggtttgt
cctgaaaaagcaatttcttatcagtttagatttaataagggatgctgtgcgcctgtgcca
aaaacgaagcttgcaaaaggaattcaaaaattctttgcgccagaaaatctgttcaggttt
gcggcttttacgttcggggcgattatgtcttcggcttttacaattaattcaatcgaaata
attttgaaattttttgcacattaa

DBGET integrated database retrieval system