KEGG   Treponema succinifaciens: Tresu_2489Help
Entry
Tresu_2489        CDS       T01461                                 

Definition
(GenBank) hypothetical protein
  KO
K09792  uncharacterized protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD_2 GUB_WAK_bind
Motif
Other DBs
NCBI-ProteinID: AEB15351
UniProt: F2NWN2
Position
complement(2650352..2650984)
Genome map
AA seq 210 aa AA seqDB search
MILEAVLLGLSTGTYCAMYCGPVLIPFLFGTEKISCRRNAGLIGLFLASRLAIYFVLGVA
LSAAGLLASEFFDPYFARRLSVCAYIFCGASLLLNSFGAKFPWEKDGCKCAGLKKLGNDF
LTAVFTGLAVGLHICAPLWTAIARSVFLPGIKGIFYLVFFYVGTLPFFLPLFGIPLVQKM
FPVLKRISRIAQLLIGFYFLIFEGLIKLFF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaggctgtgcttttggggctttcaacaggaacttactgcgcaatgtactgc
ggtcctgtgctgattccgtttttattcggaacagaaaaaatttcttgcaggcggaatgcg
ggattgattggattatttttggcttcaaggcttgcgatatattttgttcttggagttgct
ttaagcgcggcaggtcttcttgcaagtgaattttttgatccgtattttgcaaggcgcctt
tctgtatgcgcttatattttttgtggagcgagtttgcttttaaattcattcggcgcaaaa
tttccctgggaaaaagatggctgcaaatgcgctggcttaaaaaaactaggaaatgatttt
ttgactgcggtttttacggggcttgcggtgggacttcatatttgcgctcctttgtggact
gctattgctcgttctgtctttttgcccggcattaaaggaattttttatcttgttttcttt
tacgttggaactcttccgttttttcttccgctttttggaattccgcttgtccaaaaaatg
tttcctgtgctgaaaagaatttcacgtattgcgcaacttttaatcggattttatttcctt
atttttgaaggcttgataaaactgtttttttaa

DBGET integrated database retrieval system