KEGG   Treponema succinifaciens: Tresu_2490Help
Entry
Tresu_2490        CDS       T01461                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00970  Aminoacyl-tRNA biosynthesis
Module
tsu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tresu_2490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tsu01007]
    Tresu_2490
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tsu03016]
    Tresu_2490
   03029 Mitochondrial biogenesis [BR:tsu03029]
    Tresu_2490
Enzymes [BR:tsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Tresu_2490
Amino acid related enzymes [BR:tsu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Tresu_2490
Transfer RNA biogenesis [BR:tsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tresu_2490
 Prokaryotic Type
   Other AARSs
    Tresu_2490
Mitochondrial biogenesis [BR:tsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tresu_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AEB15352
UniProt: F2NWN3
Position
complement(2651159..2652991)
Genome map
AA seq 610 aa AA seqDB search
MENSKRTVTCGELTKADVGKKVVLNGWVSRTRDLGGLIFIRLRDRYGITQVMVGDNASDE
VKKIAASLKSEYCIAVEGVVAARAEKDVNKDMATGEIEVEACDIEIFTTSQELPFSIEEV
RQKDGTLVVANEDLRLKYRYLDLRREPMQHNIILRSAVTFATREFLTSKGFLEIETPTFI
KSTPEGARDYLVPSRVHPGKFYSLPQSPQLYKQLLMVSGFDKYFQIARCYRDEDARGDRQ
PEFTQIDMEMSFTNREEVLDTTEELMRHIFKKTLNYELPVHFDRISWDDAFDLYGSDKPD
LRFDMKMQDAAFMADLSDFNAFKAGAANADKNIERHKRSGLKALVVKNAADKYSRKHIEA
LEAVAKINHAKGLAWMKVDAEGKFEGGISKFFAGKEAEICSRLGAEKNDLLLFVSDEKWQ
TACVALGAVRKQLGKDLNLYNPKDEFHFAWIIDFPYFAWNEEENHWETEHHMFTLPQKKY
WDTLESDPGSVKGDLYDLVLNGYELASGSMRINDPALQERIFEIVGYSRERAEKAFGFLV
QAFKFGAPPHGGIAPGLDRLIMLMCHEESIHEVIAFPKNNLAMSPMDECPSAVDQSQLDD
LHLKCTEVEK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattctaaacgaactgtaacttgcggcgagcttactaaggctgacgttggcaag
aaagttgtattgaacggttgggtcagccgaacgcgcgaccttggcggacttatttttatc
cgtttgcgcgaccgctatggaattactcaggtaatggttggcgacaacgcttcggacgaa
gttaaaaaaatcgccgcttccttaaagtcggaatattgtatcgctgttgaaggcgttgtt
gccgcacgtgctgaaaaagacgtgaacaaggacatggcgaccggcgagattgaagttgaa
gcttgcgacatagaaatctttacaacgtcgcaggaattgccttttagcattgaagaagtc
cgccagaaggatggaactcttgttgttgcgaacgaggatttgcgcctaaaataccgctat
cttgatttgcgccgcgaacctatgcagcacaacatcatcttgcgttcggctgtaactttt
gccacacgcgaatttttgacttccaagggttttttggaaattgaaactcctacttttatt
aaatcaacaccggaaggcgcgcgcgactaccttgttccgagccgtgttcatccgggaaaa
ttctattctttgccgcagtcgccgcagctttacaagcagcttctgatggtttcgggattt
gacaagtatttccagattgcgcgctgttaccgcgatgaggatgcccgcggagaccgccag
ccggaatttacccagattgatatggaaatgagctttacaaaccgcgaggaagttctggac
acaacagaagagcttatgcgccacattttcaagaaaaccctgaactacgagcttccggtt
cattttgacagaatcagctgggacgatgcttttgacctttacggaagcgacaagccggac
ttgcgctttgacatgaagatgcaggacgcggcttttatggcggatttgagcgactttaac
gcattcaaggctggagccgcaaacgcagacaagaacatcgagcgacacaagagaagcgga
cttaaagcccttgttgtaaagaacgccgcggacaaatattcaagaaagcacattgaagcg
cttgaagcagttgcaaaaatcaaccacgctaaaggccttgcctggatgaaggttgacgcg
gaaggaaaatttgaaggcggaatctcaaagttcttcgccggaaaagaagcggaaatctgc
tcaaggcttggagcggaaaagaacgaccttcttttgtttgtaagcgacgaaaaatggcag
acagcgtgcgttgcgctcggagcggtccgcaagcagcttggaaaagacctgaacctttac
aacccgaaagacgaattccacttcgcatggattatcgacttcccgtactttgcatggaac
gaggaagaaaaccactgggaaacagagcaccacatgttcacgcttccgcagaaaaaatac
tgggacactttggaaagcgacccgggttctgtaaaaggcgacctttacgaccttgtcctg
aacggctacgagcttgcctcaggctcaatgcgtatcaacgacccggcgctgcaggaacgc
atctttgaaatcgtaggctacagccgcgagcgtgcagaaaaagcgttcggattcttggta
caggcattcaagttcggagcgccgccgcacggaggaatcgccccaggccttgaccgcctt
ataatgctcatgtgccacgaggaaagcatccacgaagtaatcgccttcccgaagaacaac
cttgcaatgtcgccgatggacgaatgcccaagcgcggttgaccaaagccaattggatgat
ttgcatctaaagtgtacagaagttgagaaataa

DBGET integrated database retrieval system