KEGG   Treponema succinifaciens: Tresu_2496Help
Entry
Tresu_2496        CDS       T01461                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
tsu  Treponema succinifaciens
Pathway
tsu02010  ABC transporters
Module
tsu_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Tresu_2496
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsu02000]
    Tresu_2496
Transporters [BR:tsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    Tresu_2496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEB15358
UniProt: F2NWN9
Position
complement(2660342..2661190)
Genome map
AA seq 282 aa AA seqDB search
MKKPLAGYFPIFLLPTLLAFAMFFVVPFLMGIGLSFTDFPTVTDATWVGFANYIKAFTAD
NEFIHALGFTSLFTVVSIVTVNVFAFSLAVLLTRELKGVAIFRSIFFMPNLIGGIVLGYI
WNLLINGVLSHFGMDITFKTQFGFWGLVILTNWQLIGYMMVIYIAGLQNIPNDLIEAAQI
DGASPMTVLFKIKIPMVMPSITICTFLTLTNTFKMFDQNLALTAGAPEKTTEMLALNIYN
TFYGRNMHWHGVGQAKAVVFFIIVAAIAFIQLKLTNQKEVEQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccattggcggggtatttccctatatttcttttgcctactttgctggcattt
gcaatgttttttgtggttccatttttaatgggaatcggactttcttttacggattttcct
actgttacagatgctacttgggttggctttgcgaactatattaaggcttttactgcagac
aatgaatttattcacgccttgggatttacttcattattcactgttgtttcaattgtaact
gtaaatgtttttgcattcagccttgcggttcttcttacaagggaacttaaaggtgtcgcg
attttccgctcgattttctttatgccgaacttaattggcggaattgttttgggatatatt
tggaaccttcttataaacggtgttctttcgcactttggaatggacataacttttaagact
cagtttggtttttggggacttgtaatccttacaaactggcagctcattggatatatgatg
gtaatttatattgccggacttcagaatattccaaatgacttgattgaggcggctcagatt
gacggtgcttctccaatgactgtccttttcaagattaaaattccaatggtaatgccttca
attacaatttgtactttccttacgcttacaaacacatttaagatgtttgaccagaacttg
gcgttgacagctggcgctccagaaaaaacaaccgagatgcttgctttgaatatatataac
actttctacggacgcaatatgcactggcacggagtaggacaggccaaggctgttgttttc
tttatcatcgttgcggctattgcatttattcagcttaagcttacaaaccagaaggaggtt
gaacaatga

DBGET integrated database retrieval system