KEGG   Treponema succinifaciens: Tresu_2503Help
Entry
Tresu_2503        CDS       T01461                                 

Definition
(GenBank) Ribosomal RNA small subunit methyltransferase E
  KO
K09761  16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tsu03009]
    Tresu_2503
Enzymes [BR:tsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     Tresu_2503
Ribosome biogenesis [BR:tsu03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Tresu_2503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: AEB15365
UniProt: F2NWP6
Position
2668826..2669590
Genome map
AA seq 254 aa AA seqDB search
MNICLFSPEEILNPLDIQDERAQHILKILHKKEGESFSAGIIGNQAGTAVIKKISVEEKK
SSDGKKIFKGGKIYFDFTPESDGKKLYPLKMIIGFPRPIQLKRLLRDMASLGVQEVHLTG
TELGEKSYLKSDLATKGEAEKFLLDGSVQAGSTQIPKLFIHQTLKNCLEQIDLEGKLLAL
DNIEPSQSLSCALKEKPQKAIAAIGSERGWTNYERQLFRQNGFELLSMGKRILRTETAST
VAVSLILNSMEVLD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctgtcttttttccccggaagaaattttaaatccgcttgacattcaagatgag
cgcgcacagcacattctgaaaatcctgcacaaaaaagaaggcgaaagtttttcagcagga
atcattggaaatcaggctgggactgccgtcataaaaaaaatttccgttgaagaaaaaaaa
tcttctgacggaaaaaaaatatttaaaggcggaaaaatctattttgactttacacctgaa
tccgacggaaaaaaactttatccacttaaaatgattattggttttccacggccgattcag
ctcaagcggcttttgcgcgacatggcatctttgggcgtgcaggaagttcaccttacagga
actgagcttggtgaaaaatcatatttaaaatcagaccttgcaacaaaaggagaagcagaa
aaatttcttttggacggaagtgttcaggcaggctctactcagattccaaaactttttatt
caccaaacgttaaaaaactgccttgaacaaattgacctcgaaggaaaacttcttgcgctt
gacaacattgaaccttctcagagcctttcatgcgcgttaaaagaaaaaccacaaaaagca
atagccgcaattggaagcgaacgtggctggacaaattacgaacgtcagctttttaggcaa
aacggctttgagcttttaagcatgggaaaaagaattctacggactgaaacagcgtcaaca
gtcgctgtctcacttattttgaattcaatggaagttttggactaa

DBGET integrated database retrieval system