KEGG   Treponema succinifaciens: Tresu_2504Help
Entry
Tresu_2504        CDS       T01461                                 

Definition
(GenBank) protein of unknown function DUF763
  KO
K09003  uncharacterized protein
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Tresu_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF763
Motif
Other DBs
NCBI-ProteinID: AEB15366
UniProt: F2NWP7
Position
2669592..2670836
Genome map
AA seq 414 aa AA seqDB search
MIKRTGHADLTLHVGTVPKWLADRMRDLGTLIVESLLIQYGKKEVLRRLSDPLWFQSFGA
VLGMDWHSSGITTSVMYALKRGINPRARDFGLCVCGGRGKYSRRTPQELLYLSEATGLDG
TSLVNASRLSAKVDGAAVQDGFQLYQHNFILSDQGDWAIVQQGMNTQTKTARRYHWCSQN
LNSFVEEPHSGITGENKGLILNLTDSSASSTRNSILELSKEKPEKIIAEIKSVQKFGLPQ
KIQHELFEDETEIQIQNERNITLPSHHNVTEKDVDLKRLGAVLATAYESPAENFENLLLT
PGLGPRTLQSLTLISEVINGTPSRFKDPARFSFAHGGKDGHPFPVPLRIYDESIRVLGDA
IEKSKLGYNDKSQCINRLHAAALQIEKNCNPKADFDKAITYEKHNSVRWGGKTV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcgtacagggcacgcagacttgacgcttcatgttggaacagttccaaaatgg
cttgcagacagaatgcgagaccttggaactttaattgtagaatcacttttaattcaatat
ggaaaaaaagaagttttgcgcagactaagcgaccctttgtggtttcagtcgttcggagca
gttctgggaatggactggcattcttctggaataaccacaagcgtaatgtacgccttaaag
cgtggaataaatccgcgtgcaagagacttcggactttgcgtttgcggcggaagaggaaaa
tattcacgcagaacaccacaggaacttttatatttaagcgaagcgactggcttagacgga
acttcccttgtaaacgcaagcaggctttcagcaaaagtagacggagccgcagttcaagac
ggatttcaactttatcagcacaattttattttaagcgaccaaggcgactgggcaatcgtt
cagcaaggtatgaatacccagaccaaaacagcgcgccgctaccattggtgctcgcaaaat
ttaaattcatttgttgaagagccgcattcaggaattacaggagaaaacaaaggactgatt
ttaaatctcacggattcttccgcatcaagcacaagaaattcaattctggaactttcaaag
gaaaaacctgaaaaaataatcgccgaaataaaatcagtgcagaaattcggactgccgcaa
aaaattcagcatgaactttttgaagacgaaactgaaatccaaattcaaaatgaaagaaac
ataacacttccctctcatcacaatgttacagaaaaagatgtggacttaaaacggcttggt
gcagttcttgcaaccgcctatgaaagtcctgccgaaaattttgaaaaccttcttttaaca
cctggacttggtcctagaacattgcagtctttaactttaatcagcgaagttataaacgga
actccaagcagattcaaagacccggcaagattcagttttgcccacggcggaaaagacgga
catccatttcctgttccgcttagaatttacgatgaaagcataagggttctaggagacgca
atagaaaaatcaaaactcggctacaatgacaaaagccaatgcataaacaggcttcatgca
gccgcccttcagatagaaaaaaactgcaatccaaaagctgactttgacaaagcaatcacc
tatgaaaagcataattcagttcgctggggcggaaaaacagtctag

DBGET integrated database retrieval system