KEGG   Treponema succinifaciens: Tresu_2505Help
Entry
Tresu_2505        CDS       T01461                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K02072  D-methionine transport system permease protein
Organism
tsu  Treponema succinifaciens
Pathway
tsu02010  ABC transporters
Module
tsu_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Tresu_2505
Transporters [BR:tsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    Tresu_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEB15367
UniProt: F2NWP8
Position
complement(2670833..2671486)
Genome map
AA seq 217 aa AA seqDB search
MSQIFVLVGQSSLQTLEMVFFSTLFSLVLGFPVGVLLYITNPTGISPRPILNQVLSRIVN
VLRSFPFIILMIVLFPLSRLMLGTSIGTEATIIPLSIAAAPFVARVIETALSEVDSGMIQ
AARAMGSTNWQIIYKVVIPEAFPSVISGITLTIINLIGYSAMAGTIGGGGLGDLAIRYGY
QRFRTDVMVAAVVVILVLVELIQFVGTVLVNKMLSKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagatttttgttttagttggccagtcatctttgcagactttggaaatggttttc
ttttcaacattgttttctcttgtgcttggttttcctgtgggtgttttgctttacattaca
aatccgactggaatttctccgcgtccgattttgaatcaggttttaagccggattgtaaat
gtcttgcgttcttttccgtttatcattttgatgattgtgctttttccgctttcacgcctt
atgttggggacaagcattggaacagaagctacgattattccgcttagcattgccgctgct
ccttttgttgcccgtgtaattgaaactgctttaagtgaagttgattctggaatgattcag
gctgcaagagctatgggctcaacaaactggcagattatttacaaagttgttattccagaa
gcttttccgtctgtgatttcaggaataacgcttacaattataaacttgattggatattct
gcaatggctggaacaattggcggcggcggacttggagacttggcgattcgatacggttat
caaagattccgtactgatgtaatggttgccgcggttgttgttattcttgtgcttgttgag
ctgattcaatttgttggaactgttcttgtaaataagatgcttagcaaacgctag

DBGET integrated database retrieval system