KEGG   Treponema succinifaciens: Tresu_2509Help
Entry
Tresu_2509        CDS       T01461                                 

Definition
(GenBank) flavocytochrome c
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00020  Citrate cycle (TCA cycle)
tsu00190  Oxidative phosphorylation
tsu00620  Pyruvate metabolism
tsu00650  Butanoate metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01130  Biosynthesis of antibiotics
tsu01200  Carbon metabolism
tsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tresu_2509
   00620 Pyruvate metabolism
    Tresu_2509
   00650 Butanoate metabolism
    Tresu_2509
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tresu_2509
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tresu_2509
Enzymes [BR:tsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Tresu_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 HI0933_like DAO FAD_oxidored FMN_bind Pyr_redox_2 FAD_binding_3 Thi4 Pyr_redox_3 GIDA Amino_oxidase NAD_binding_8 AlaDh_PNT_C Lycopene_cycl Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEB15371
UniProt: F2NWQ2
Position
2674514..2676247
Genome map
AA seq 577 aa AA seqDB search
MKHKNLRNSLAAAVFIVASGISIAVMAACSKPKALPDGTFSGRADGRNGAIEIAFSVKDG
KITSTEILKEEETDFAKPAIKSILEKFTSTGKAAGIDTVSGATITSKATLAALENAINSA
RGKKSEQTEYKDTSCDIVIIGAGGAGLSAATEAASKGAKVIVLEKMGNAGGNTISATGGL
NASETSIQKKLGIQDTNEQFFEDTMKGGHYKNNPELVRNMTEKSAETVDWLISIGADLTD
VGKMAGSTNKRTHRPQGGAAVGSNLIPALEKAALNSGAEIRYSNKVLDIIEKDGRAAGVK
VCAGSSEYTINAKAVIIATGGFGANPQMVVSYKPELEGFGTTNHKGATGDAFSWIKKFNA
GLTQMEEIQTHPTVVPGNGTMITEAVRGNGAILVNRDGKRFCTEMATRDVMSKAILAQKG
KTAFLVFDQDVRESLKAIETYIKNGLITQGETTKELAEKLGIPADEFEKTMAYYAQIQKS
GNDPLGRKPSEMPRPLTKAPFYAVEVGPAVHHTMGGITINTKAQVLDTDKNPVPGLYAAG
EVTGGIHGANRLGGNAVADICIYGKIAADTALEEIKK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaagaatctacggaattcactggcagcggcagtttttatagttgcatcagga
atttcaatagctgtaatggcagcctgttcaaagccaaaagctctgccggacggaacattt
tctggcagagcagacggaagaaacggcgcaattgaaatcgcattttctgtaaaagacgga
aaaatcacttcaacagaaatcctaaaagaagaagaaactgattttgcaaagcctgcaata
aaatcaattcttgaaaaattcacttcaacaggaaaagcagccggaattgatacagtttca
ggcgcaacaataacttccaaggcaactttagcggctttggaaaacgcaataaattcagcc
cgcggaaaaaaatcagagcaaacagaatacaaagacacttcctgcgacattgttataatc
ggagctggcggagccggactttctgcggcaacagaagctgcaagcaaaggcgcaaaagta
attgtccttgaaaaaatgggaaacgcaggcggaaacacaatttctgcgacaggcggactc
aatgcaagcgaaacttcaattcaaaagaaacttggaattcaagacacaaacgagcagttt
tttgaagacacaatgaaaggcggacactacaaaaacaatccagagcttgtgcgcaacatg
actgaaaaatccgctgaaactgtagactggctcatctcaattggcgcagacttgactgat
gttggaaaaatggcaggctcaacaaacaaacgcactcaccgaccgcaaggaggagctgca
gttggctcaaatctgattccagcacttgaaaaagccgcattaaattccggagcagaaatc
cgctattcaaacaaagttcttgacataatcgaaaaagacggaagagcggccggcgtaaaa
gtttgtgcaggaagcagcgaatacacaatcaacgcaaaagccgtaataattgcaaccgga
ggattcggcgcaaatccgcagatggtcgtttcctacaaacctgaattagaaggctttgga
accacaaaccacaaaggcgcaactggagacgcattcagctggataaaaaaattcaatgcc
ggccttactcaaatggaagaaatacaaactcaccctacagttgttccaggaaacggcaca
atgattacagaagctgtccgcggaaacggagcaattcttgtaaaccgcgatggaaaaaga
ttctgcacagaaatggcgacacgcgatgtaatgtcaaaggcgattcttgcgcaaaaagga
aaaacagcattccttgtatttgaccaggatgttcgcgaatctttaaaggcaattgaaact
tatataaagaacggacttattacccaaggtgaaaccacaaaagagcttgcagaaaaactt
ggaattccagcggatgaatttgaaaagacaatggcatattatgcgcagattcaaaaatca
ggaaacgatccgcttggcagaaagccttccgaaatgccgcggcctcttacaaaagctccg
ttctacgctgttgaagtaggtcctgcagttcatcatacaatgggcggaatcacaataaac
acaaaggcacaagttttggatacagacaaaaatccagttccaggactttatgcggctggt
gaagttacaggcggaatccacggcgcaaaccgtcttggaggaaacgcagtggcagatatt
tgcatctacggaaaaatcgccgccgacactgcgcttgaagaaattaaaaaataa

DBGET integrated database retrieval system