KEGG   Treponema succinifaciens: Tresu_2516Help
Entry
Tresu_2516        CDS       T01461                                 

Definition
(GenBank) phosphodiesterase, MJ0936 family
  KO
K07095  uncharacterized protein
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Tresu_2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos_2 Metallophos Metallophos_3
Motif
Other DBs
NCBI-ProteinID: AEB15378
UniProt: F2NWQ9
Position
2682602..2683159
Genome map
AA seq 185 aa AA seqDB search
MKWLIASDIHGSSFYCKKLLEKFNEEKADRLLLLGDILYHGPRNDLPKEYNPKIVTALLN
EYSEKISCVRGNCDSEVDQMVLNFPIMAEYAILDVGSRLIFATHGHIFNEVNPLKMPSGS
VLICGHFHVPKILKHENYLYLNTGSVSLPKENSWHSYILFDGDRFYWKDLKNDEEKLSIR
LSSEY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggcttattgcttctgatatacatggctcatctttttattgcaaaaaacttctt
gaaaagtttaatgaagaaaaagcggacagacttttgcttttaggcgacattctttatcat
ggtccaagaaatgacttgccgaaagaatacaacccgaaaattgtaactgcgcttttaaat
gaatattcagaaaaaatcagttgtgtaagaggaaactgcgattccgaagtagaccaaatg
gttttgaattttccgattatggcggaatatgcgattctcgatgttggaagcagacttatt
tttgcaacccacggacacatttttaatgaggtcaatcctttaaaaatgccaagcggaagc
gttttgatctgcggacatttccatgtgccgaaaattcttaagcacgaaaattatctgtac
ctaaatacagggtcagtttctctaccaaaggaaaattcctggcacagttatatacttttt
gatggggacagattctactggaaagacctaaaaaacgatgaagaaaaacttagtatccgc
ctatcatctgagtattga

DBGET integrated database retrieval system