KEGG   Treponema succinifaciens: Tresu_2521Help
Entry
Tresu_2521        CDS       T01461                                 

Definition
(GenBank) Anti-sigma-28 factor FlgM family protein
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
tsu  Treponema succinifaciens
Pathway
tsu02020  Two-component system
tsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tresu_2521
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    Tresu_2521
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:tsu02035]
    Tresu_2521
Bacterial motility proteins [BR:tsu02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    Tresu_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM
Motif
Other DBs
NCBI-ProteinID: AEB15383
UniProt: F2NWR4
Position
complement(2687380..2687667)
Genome map
AA seq 95 aa AA seqDB search
MMINKISEVNALNSLQNTKRSNNVAGSQYVSDEISVSDEAKAMAEAMFMNKVAEETPDVR
SELVEQIKLKIQDPNYLNEATIAATADQILSAYGL
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgatgataaacaagatttcagaggttaatgctctaaactcattgcagaacacaaaacgt
tcaaataatgttgcaggttctcagtatgtgtctgatgaaatcagtgtttccgatgaagcc
aaagccatggcagaagctatgtttatgaataaagtggcagaggaaactccagatgttcgt
tcagagctggtggagcagattaagctcaagattcaggatccaaattacctcaatgaagct
acgattgcagctactgcggatcaaattcttagtgcttacggtttgtaa

DBGET integrated database retrieval system