KEGG   Treponema succinifaciens: Tresu_2524Help
Entry
Tresu_2524        CDS       T01461                                 

Definition
(GenBank) glycoside hydrolase family 18
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18
Motif
Other DBs
NCBI-ProteinID: AEB15386
UniProt: F2NWR7
Position
2691420..2692376
Genome map
AA seq 318 aa AA seqDB search
MKKVITFIALTVLSACAFSQNKIKFNETWSYVLTGYENEFSADLPITDLCYFSAEINEYG
EIPSIPNRETVPPEFNGRVHIVAICESRSLSHFVIDPKYKVSKKIIKTLAEATKDFDGLQ
IDFELVPKRDAENFKIFLKKLKKAIGKDKMLSVCVPARTKTVQDDVYDYKELSSCADRIF
IMAYDQHWATSAPGPVSGMDWCKKIADHALNTIPVEKIIMGLPFYGRSWTEPNFSKAWYN
SGINRILGENSALEEVQRTEGIPHFEFKTEITVKGWFDDKESLAARCLMLSEKNIPNAGF
WRIGQEDKEFWQILSVPD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttataacatttattgcattaacagttctttccgcctgcgcattttctcag
aataaaatcaaattcaacgaaacctggagctacgttctcacaggatatgaaaacgagttt
tctgcggatttgccaataacggatctttgctattttagcgcggaaataaatgagtacggc
gaaattccttcaattccaaatcgtgaaactgttccacctgaattcaacgggagagttcat
attgttgcaatttgcgaaagccgctctctaagccattttgtaatcgacccgaaatacaaa
gtttcaaaaaaaattattaaaactctggcagaagcaacaaaagacttcgacggacttcaa
attgactttgagcttgttccaaaacgagatgctgaaaatttcaaaatttttcttaaaaaa
ctgaaaaaagcaatcggcaaagacaaaatgctttctgtttgcgttcctgcaagaacaaag
acagttcaagatgatgtctacgattacaaagagctttcatcttgcgcagacagaattttt
ataatggcttacgatcagcactgggcaacaagcgcacccggtccggtttctggaatggac
tggtgcaaaaaaattgcagaccatgcattgaatacaattccagttgaaaaaataataatg
ggcttgcctttctacggaagaagctggacagaaccaaatttttccaaagcatggtataac
agcggaatcaacagaatccttggcgaaaattctgcattagaagaagttcaaagaactgaa
ggaattccgcattttgaattcaaaacagaaattacagtaaaaggctggtttgacgacaaa
gaatctttagccgcaagatgtcttatgctttctgaaaaaaacattccaaatgctggattc
tggagaattggtcaggaagacaaagagttctggcaaattctttctgttccagattaa

DBGET integrated database retrieval system