KEGG   Treponema succinifaciens: Tresu_2526Help
Entry
Tresu_2526        CDS       T01461                                 

Definition
(GenBank) NLPA lipoprotein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
tsu  Treponema succinifaciens
Pathway
tsu02010  ABC transporters
Module
tsu_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Tresu_2526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsu02000]
    Tresu_2526
Transporters [BR:tsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    Tresu_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 Phosphonate-bd PepSY_2 OpuAC FOXO-TAD DUF4148
Motif
Other DBs
NCBI-ProteinID: AEB15388
UniProt: F2NWR9
Position
2694283..2695062
Genome map
AA seq 259 aa AA seqDB search
MKKILTLAAAVFAAALLSAQAKLKVGATPVPHAEMLNLVKDDLKAQGVDIQVIEMTDYVI
LNDALESGELDANFDQHIPYMESTNKEKGYHLVNAGGIHIEPIALYSKKVSKLSDLKKKA
TIAIPNDPTNGGRALLLLQAAGLIELKKDAGITATTLDIAKNPLKLKFKELDAASIPRTL
NDVDAAVINGNYAIPAGLSATKDGLFVEGKDSPYVNIIAVKDGNQNDPRVKALVKALQSD
KIKNYISEKFKDGEVVAAF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaacattggctgcggcagtttttgcagccgctcttttgtctgcacag
gcaaaactaaaagttggagcaactcctgttccccatgcagaaatgctcaatcttgtaaaa
gatgatttaaaggctcagggtgttgacattcaggttattgaaatgacagattatgttatt
ctcaacgatgcccttgaaagcggcgagcttgatgcaaactttgaccagcacattccttac
atggaatccacaaacaaggaaaaaggctatcaccttgtaaatgcaggcggaatccacatc
gagccaatcgccctttattcaaaaaaagtttcaaagctttctgatttgaagaaaaaggcg
acaattgcaattccaaacgatcctacaaacggcggacgcgcgcttttgcttcttcaggca
gcaggacttattgaacttaaaaaagatgcaggaataacagcgacaacactcgacatagca
aagaatccgcttaagctgaaattcaaggagcttgacgcagcttcaattccacgcactttg
aacgatgttgatgcggctgttatcaacggaaactatgcaatcccggcaggactttcagca
acaaaagacggactttttgtagaaggaaaagattcaccttatgttaacattatcgctgta
aaagacggaaaccagaatgatcctcgtgtaaaagcacttgtaaaggcattgcagagtgac
aaaatcaagaattacatttctgaaaaattcaaagacggtgaagtcgtagccgcattctaa

DBGET integrated database retrieval system