KEGG   Treponema succinifaciens: Tresu_2528Help
Entry
Tresu_2528        CDS       T01461                                 

Definition
(GenBank) Aspartate transaminase
  KO
K10907  aminotransferase [EC:2.6.1.-]
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tsu01007]
    Tresu_2528
Enzymes [BR:tsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     Tresu_2528
Amino acid related enzymes [BR:tsu01007]
 Aminotransferase (transaminase)
  Class I
   Tresu_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEB15390
UniProt: F2NWS1
Position
complement(2696733..2697905)
Genome map
AA seq 390 aa AA seqDB search
MNTREDKFSSSMVQTPPSGIRKFFEMLIGHDDVISLSVGEPDFPTPWCIREEAFYHLEKG
HTSYTSNWGLLELREEISKYMQKYNMHYNPQKEILITVGASEGVDASLRAILNPGDEIIV
CQPCYVNYVPLARLCEVNVVPIDTSVNGFYPTAEQIEKAVTPKTKAVMICSPNNPTGTMI
PKDELEKIAEIVKKHQLWVISDEIYCELAYDGSEHVSIGSFPEMKDYTIILNGFSKSFAM
TGWRIGYIAAPAELLAQIVKLHGYNTICAPIFSQYAATEGLRNGWSEVEKMRVSYQQRRN
LMYKAFCDMGLSVPEPSGAFYMFPDISSTGLSSEEFATKLFQKHNVAVVPGSVFGAGGEG
HIRCCYATAIDKIKVALDRIADFVQECRKN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaagagaagacaaattcagttcatcaatggtgcagactcctccaagcggaatt
cgaaaattttttgaaatgttgattggacacgatgatgtgatttcgctttctgttggagag
cctgattttccgactccatggtgtattcgcgaggaagctttttatcatcttgaaaaggga
catacaagctacacttcaaactggggcttgcttgagctgcgtgaagaaatttcaaaatat
atgcagaaatacaatatgcattataatccgcagaaggaaattcttataacagttggagca
agcgaaggcgttgatgcttctttgcgtgctattcttaatcctggagatgaaattattgtc
tgccagccttgctacgtaaattatgttcctttggcgcgtctttgtgaagtcaatgttgtt
ccaattgatacaagcgtgaatggattttatccgacagcagagcaaattgaaaaagcagtt
actccaaaaacaaaagcagttatgatttgttccccgaacaatccgactggaactatgatt
ccaaaagatgaacttgaaaaaattgcggaaattgtaaaaaaacatcagctttgggttata
agcgatgaaatttactgcgagcttgcttatgacggctcagaacacgtttcaatcggctct
ttccctgaaatgaaagactacacgattattcttaacggattttcaaaatcttttgcaatg
acaggctggcgaatcggatatattgcggctcctgcggaacttcttgctcagattgtaaag
ctccacggatacaatacaatttgcgccccgattttcagtcagtatgcggctacggaaggt
ttacgcaacggctggtctgaagttgaaaaaatgcgtgtaagctatcagcagcgaagaaat
ttgatgtacaaggcgttttgtgatatgggactttctgttcctgagccttccggagctttt
tatatgttcccggacatttcgtcaacaggactttcaagtgaagaatttgctacaaagctt
tttcaaaagcataatgtcgctgttgttccgggaagcgtttttggcgcaggaggagaaggg
cacataagatgctgctatgcaaccgctattgataaaattaaagttgctttggatagaatt
gcagattttgttcaggaatgccgaaaaaattaa

DBGET integrated database retrieval system