KEGG   Treponema succinifaciens: Tresu_2531Help
Entry
Tresu_2531        CDS       T01461                                 

Definition
(GenBank) Histidine biosynthesis protein HisG domain protein
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00340  Histidine metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Tresu_2531
Enzymes [BR:tsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     Tresu_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG HisG_C Alpha_E3_glycop
Motif
Other DBs
NCBI-ProteinID: AEB15393
UniProt: F2NWS4
Position
complement(2699058..2699930)
Genome map
AA seq 290 aa AA seqDB search
MEKLKILLAKGRIYESVYELLSDVGISLKLPDRTYFPITNQKDLAFQVVKPQIASVLLAA
NKADIAFSGKDWVFENGVEDSLVEIMDLGFDPVRVVAAIPEDFDYEELAKKNVTIATEYQ
NLSKKWVEAKKINGTIFRTWGTSEGFVQNTEDSIAQILIDNTSTGSSLKANRLKIVDTLM
ESSTRMYASKEAMADPEKKQKILELKMLFSAVLDARDRVMLEMNVSKEKFDTLVKAIPSM
RSPTVSPLFGDSGYAVKTAVKKSEVPVLLPKLKEFGATDILEYELRKVMS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattaaaaattttattggcaaaaggaagaatttacgaatctgtatatgagctt
ttaagtgatgttggaatttctttaaagcttccagacaggacatattttcctataacaaat
caaaaagatcttgcgtttcaagttgtaaaacctcagattgcgagtgttcttcttgcggca
aataaagcggatattgctttttctgggaaagactgggtttttgaaaatggcgttgaagat
tcgcttgttgaaataatggatttgggatttgatccagtccgtgtcgttgccgcgattcca
gaagattttgactatgaagagcttgcaaagaaaaatgttacaattgcaactgaataccag
aatctaagtaaaaaatgggttgaagcaaaaaaaatcaacggaacaattttccgtacttgg
ggaacaagcgaaggatttgttcagaacacagaagattcaattgcgcagattcttattgat
aatacaagcacaggctcttctttaaaggcgaaccgtttaaaaattgtggacactctcatg
gaaagttctacaagaatgtatgcgtcaaaagaagcgatggctgacccggaaaaaaaacaa
aaaattcttgaacttaaaatgcttttttctgcggttcttgatgcgcgcgaccgtgtcatg
cttgagatgaatgtttccaaggaaaaatttgacacgcttgtaaaggcaattccgtctatg
agaagcccgaccgtaagccctctttttggtgattcgggatatgctgtaaaaactgctgtt
aaaaaaagtgaagttccagttcttcttccaaagctcaaagaatttggagctacagacatt
ttggaatatgaacttagaaaagtcatgtcataa

DBGET integrated database retrieval system