KEGG   Treponema succinifaciens: Tresu_2532Help
Entry
Tresu_2532        CDS       T01461                                 

Definition
(GenBank) Ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00030  Pentose phosphate pathway
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01130  Biosynthesis of antibiotics
tsu01200  Carbon metabolism
tsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tresu_2532
Enzymes [BR:tsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Tresu_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A
Motif
Other DBs
NCBI-ProteinID: AEB15394
UniProt: F2NWS5
Position
complement(2699982..2700701)
Genome map
AA seq 239 aa AA seqDB search
MGISKDGQKILAATTAIDSLIKEGKIFSGMKIGLGTGSTAMPAVKRLAQRIEDGTLKDIK
AVATSFQTTLACEELGIPVYTLNDRAINGTLDLAIDGADEIDPDNNLIKGGGAALLREKI
IAYNSSNFAIVADSSKDVKSLGTGFALPVEIIAEARVPVIKALEKLGAECVLREGVKKAG
PVITDNGNLILDCKWKSPVNPHEMEEKIDGIIGVVECGFFTKIKPEVFIAKSDGTVERR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttctaaagacggacaaaaaattttagccgcgacaacagcaattgattcttta
atcaaagaaggaaaaattttcagcggaatgaaaatcggacttggaactggctctactgca
atgccggctgtaaaaagacttgcgcagagaattgaagacggaactttaaaagatataaaa
gccgttgcaacaagttttcagactacattggcctgcgaggaacttggaattccagtttac
acattgaatgacagagcaataaatggaactcttgaccttgcaattgacggcgcggacgaa
attgatccagataacaatcttataaaaggcggcggcgcggcattgctccgtgaaaaaatc
attgcatataattcatcaaactttgcaattgttgcggattcttcaaaagatgtaaaaagc
cttggaactggttttgctcttcctgttgaaattatagcagaagcccgtgttcccgtaatt
aaagctttggaaaaacttggcgcggaatgtgtgctgcgtgaaggtgtaaaaaaagccggt
cctgtaattacagacaacggaaatctaatcttggactgcaaatggaagtctccggttaat
ccgcatgaaatggaagaaaaaatcgatggaataatcggtgttgttgaatgcggatttttt
acaaagataaagccagaagtttttattgcaaaatctgacggaactgttgagcgccgctag

DBGET integrated database retrieval system