KEGG   Treponema succinifaciens: Tresu_2534Help
Entry
Tresu_2534        CDS       T01461                                 

Definition
(GenBank) hypothetical protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C_3 Tfb2
Motif
Other DBs
NCBI-ProteinID: AEB15396
UniProt: F2NWS7
Position
complement(2702196..2704292)
Genome map
AA seq 698 aa AA seqDB search
MNLDAKVQKIIQWRESFCTLPDKFFFELVRIYLGEVKTPYNKQKLAEEIGAFLRKKETRD
SIVKFLDGTDIKILTAIKFLNEPDIEKLEKFFSSSIQQGDFYSAVASLEERLLIFSVHVK
NEKNLIKINPYLEDDLSGLLNLQNLISPENEKKFPERRLKISSDLLAVFICYISSHPDIC
KNNGELKKKASSDLAEIFQENFNKEFFETLFKALKNLHLVQEDSEGKGFFVDWQRLELFS
NLTFGNQVAYICAACTGSFSRSMILSSAEIFFKTLSFLKQEVYTRQKIIQIVFLLKDKNS
RYSENSFSRFSRIVAFGSSAENSSVDSKFLDAMLDCAIELGIVDSLSEGENEFIRVNQIF
EENKSQGSLSIDAGFSVIVLPGFLLSDLVPLIKFLCPKKCDTAAVFEITRQSVLKAFDFD
MTKDQISSILKKYSHYEIPQNLLVSLDEWADSYNSAALYKGYVLKICPENSIVIEKKLSS
YIIEILSPGIFLMNFSSDEQAKNCVERLGLDFVGNVKSTKKTAPALGFPEIDFDSKILAC
SSEILPIENSMISGSKKEVSKILEDLKNQLENISASAEQKEGLEERIKRRVVLSSAQLRP
ESVKFELTEASGMNFTGKLRVLESAVQNEDLVEIEMSTTKEILIGVPRAVVKNQILFLVC
KNPETNSVEEYEISIALISKVKKIRSSASFLNLVAKES
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagatgcaaaagttcaaaagataattcaatggcgtgaaagtttttgcactttg
ccggacaaattttttttcgagttggtacgtatttatcttggagaagtaaagactccttac
aacaagcaaaagctggcggaagaaataggagcttttctgcgcaaaaaagaaaccagggat
tcaattgtaaaatttcttgacggcactgatataaaaattcttacagcgataaaattttta
aacgagcctgacattgaaaaacttgaaaaatttttttcatcttcaattcagcagggagat
ttttacagcgcagttgcaagccttgaagaacgtcttttgattttttctgtccatgtaaaa
aatgaaaagaatttaataaaaataaatccgtatcttgaagatgatttgagcggcttgttg
aatttgcaaaatttgataagtccagaaaacgaaaaaaaatttcctgagcgccgactaaaa
atttcttctgatcttcttgcggtttttatctgctatatttcaagccatcctgatatttgc
aaaaacaacggggaacttaaaaagaaagcgtcttctgacttggctgaaatttttcaggag
aatttcaacaaggaattttttgaaacactttttaaagctctcaaaaatcttcatcttgtc
caggaagattctgaaggcaaaggattttttgttgactggcagaggcttgagcttttctcg
aatttgacttttgggaatcaggttgcttatatttgcgctgcttgcacaggttccttttcc
cgaagcatgattttgtctagcgcggaaatttttttcaagacactttcatttttaaagcag
gaagtttacacaaggcagaaaattattcagattgtttttttgctgaaagataaaaattcc
cgctattcagaaaattctttcagccgtttttcaagaattgttgcgtttggttcttccgcg
gaaaattcttctgttgattcaaagtttttggatgcgatgcttgactgcgcgattgagctt
ggaattgtcgattctctttctgagggcgaaaatgaattcatccgtgtgaatcaaattttt
gaagaaaataaatcgcaaggctctttgagcattgatgcaggtttttcagttatagttttg
ccgggatttttgctttcggatcttgttccgcttataaaatttctttgtccaaaaaaatgt
gatactgctgctgtttttgaaattacgcgccagtctgttttaaaagcttttgattttgat
atgacgaaagatcagatttcctcaattttgaaaaaatattcgcattatgaaattccgcag
aatcttttggtttcgcttgatgaatgggcggattcttataattcagccgcgctttacaaa
ggctatgttttaaaaatttgtcctgaaaattctattgtaattgaaaagaaactttcatcg
tatatcattgaaattttgtcgccgggaatttttctgatgaatttttcatccgatgaacag
gcaaaaaattgcgttgagcgccttggacttgattttgttggaaatgtaaaatccacgaaa
aaaactgcgcctgctttgggatttccagaaattgattttgattctaaaattctggcttgc
tcttccgaaattttgcctatagaaaattctatgatttctggttcaaaaaaagaagtttct
aaaattcttgaggatttgaaaaatcagcttgaaaatatttcagcttctgcagagcaaaaa
gaaggacttgaggagcggataaaacggcgcgtggttttgtcttcggctcagcttaggcct
gaaagcgttaagtttgagcttaccgaggcaagcggaatgaatttcaccggaaagctcagg
gttttggaaagcgcagttcaaaatgaagatttggttgagattgaaatgtctacgacaaaa
gaaattttaataggcgttccaagggctgttgtaaaaaatcagattctttttttagtttgc
aaaaatcctgaaacaaattcagttgaagaatacgaaatttcaattgccttgatttcaaaa
gtaaaaaaaatcagaagctcggcttcatttttaaatttagttgcaaaggagtcttga

DBGET integrated database retrieval system