KEGG   Treponema succinifaciens: Tresu_2535Help
Entry
Tresu_2535        CDS       T01461                                 

Definition
(GenBank) helicase domain protein
  KO
K10843  DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
tsu  Treponema succinifaciens
Pathway
tsu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    Tresu_2535
  09124 Replication and repair
   03420 Nucleotide excision repair
    Tresu_2535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tsu03021]
    Tresu_2535
   03400 DNA repair and recombination proteins [BR:tsu03400]
    Tresu_2535
Enzymes [BR:tsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tresu_2535
Transcription machinery [BR:tsu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Tresu_2535
DNA repair and recombination proteins [BR:tsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Tresu_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C SNF2_N
Motif
Other DBs
NCBI-ProteinID: AEB15397
UniProt: F2NWS8
Position
complement(2704289..2706076)
Genome map
AA seq 595 aa AA seqDB search
MPESENPLIVQSDRTLLLDVHAPLAEECRAALIPFAELVRSPEHLHTYQISSLSLWNAES
SGFTGEQAVEVLKKFSRYEIPQSVVVWIEETSGRFGKLRLVQGPSVENSDGIKEEYLYLV
SNSPYVFKQIEANAFARKFLVPCECAEEFSAGLSEKEKTFCFKLLLTDRGIIKQNLLKIG
WPVKDDVPLQDGFPLEINLRKTTFSGRSFEVREYQKAAANALVGNKGPGTGFGTIVLPCG
AGKTIVGMEIMSLLKTNTLIVTTNITAVHQWIDELIDKTDLDASQIAEYTGENKTIKPVT
VATYQILTWRPDKNGPYPHFSLFRQNNWGLVIYDEVHMIPAPVFRVAAELQAVRRVGLTA
TLVREDGCEGNVFSLVGPKRYDVPWKELEKAKWIAKAECIEVRLGLPENKEIEYAVAANR
EKHRIASENPLKNKIVQELVEKFKDDKILIIGQFLTHLEIIAKLLNVPIITGKTKNSERD
IIYDDFRSGKIRVLVVSKVANFAIDLPDASVAIQVSGTFGSRQEEAQRLGRILRPKERTS
RFFTLITRGTVEEDFGSNRQKFLAEQGYSYRIVRYENEKSFDDLEVPIQIEGCGQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaagcgaaaatcctttgattgttcagtctgacagaacgcttttgcttgatgtc
catgcgcctcttgccgaagaatgcagggctgccttgattccttttgcggaacttgtgcgc
tctcctgaacatttgcatacatatcaaatttcatctctttcattgtggaacgctgaaagc
tcaggatttacaggcgaacaggcggttgaggttttaaaaaaattttcacgttatgaaatt
ccgcagagcgttgttgtttggattgaagaaacttccgggcgttttggaaaactcaggctg
gttcaggggccttccgtggaaaattcagacggaataaaagaagaatatctttatcttgtt
tcaaattctccgtatgtttttaagcagattgaagctaatgcttttgccagaaaatttctt
gttccgtgcgaatgtgcagaagaattttcagcaggactttcagaaaaagaaaaaacgttt
tgctttaaacttttgcttactgaccgcggaattattaagcagaatctattaaagattggc
tggcctgtaaaagatgatgttcctcttcaggacggatttcctcttgaaataaatctgcgg
aaaacaacttttagcggacggtcttttgaagtgcgtgaatatcagaaagctgctgcaaat
gcgcttgttggaaacaaaggtccgggaactggattcggcacgattgttcttccttgcggc
gcgggcaaaacgattgtcggcatggaaataatgagccttttaaagacaaatacgcttatt
gtaactacaaatattacagctgttcatcagtggatagacgagcttattgataaaactgat
ttggatgcaagccagattgcggaatatactggagaaaataaaactataaaaccagtaacg
gttgccacttatcagattcttacttggcgtcctgacaaaaacggcccgtatccgcatttt
tcacttttcaggcagaacaactgggggcttgttatttacgacgaagtccacatgattccg
gctcctgtttttagagttgcggcagaacttcaggctgtgcggcgtgtcggtctgactgcg
actcttgtgcgtgaagatggttgcgagggcaatgttttttctttggttggtccaaaaaga
tatgatgttccttggaaagagcttgaaaaagcaaagtggattgcaaaggctgaatgtatt
gaagttcgccttggacttcctgaaaataaagaaattgaatatgcagttgcggccaacaga
gaaaagcacagaattgcaagtgaaaatcctttgaagaataaaattgttcaggagcttgtt
gaaaaattcaaggatgacaaaattcttataatcgggcagtttttaactcatcttgaaatt
attgccaagcttttgaatgttccgattattaccggcaaaacaaaaaactccgaacgtgat
ataatttatgacgattttcgaagcggaaaaatacgtgtgcttgttgtcagcaaggttgcg
aattttgcaatcgatttgccggacgcgagcgtggcaattcaagtgagcggaactttcggt
tcaaggcaggaagaagctcagcggcttggaagaattcttcgtccaaaagaaagaacttca
agattttttactttgattacgcgcggaacagttgaagaagattttggaagcaaccgacaa
aaatttttagcagagcaaggatattcctatagaattgtccgctacgaaaatgaaaaaagt
tttgatgaccttgaagttccgattcaaatcgaaggatgtggccaatga

DBGET integrated database retrieval system