KEGG   Treponema succinifaciens: Tresu_2537Help
Entry
Tresu_2537        CDS       T01461                                 

Definition
(GenBank) ferric uptake regulator, Fur family
  KO
K09825  Fur family transcriptional regulator, peroxide stress response regulator
Organism
tsu  Treponema succinifaciens
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsu03000]
    Tresu_2537
Transcription factors [BR:tsu03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    Tresu_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR TrmB Benyvirus_14KDa ADK_lid
Motif
Other DBs
NCBI-ProteinID: AEB15399
UniProt: F2NWT0
Position
2707191..2707595
Genome map
AA seq 134 aa AA seqDB search
MNHEQIAAKLEEKNIRPSVQRMAIYNFLAENPVHPTVDTIYTALSPQMPTLSRTTVYNTL
RQFSECGLVQTITIEDGELRYDADTSNHLHFKCIKCGKIYDIFKPVELPPQFLQDGFKAE
KIQTNIWGICKDCS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgaacaaatcgcagcaaaactagaagaaaaaaatatccggccgtcagttcaa
agaatggcaatttacaactttcttgcggaaaatccagtgcatccgaccgttgacacaatt
tacacagcactttctccgcaaatgccaacattatctcgaacaacagtttacaacactctt
aggcaattttctgaatgcggactcgtgcagacaattacaattgaagacggcgaacttaga
tatgatgcggacacttcaaatcatctgcactttaaatgtataaaatgtggaaaaatctac
gacatttttaagccagtcgaacttccgccacagtttttgcaagacggattcaaagcggaa
aaaattcaaaccaacatctggggaatttgcaaagactgctcttaa

DBGET integrated database retrieval system