KEGG   Treponema succinifaciens: Tresu_2538Help
Entry
Tresu_2538        CDS       T01461                                 

Definition
(GenBank) hypothetical protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PrsW-protease
Motif
Other DBs
NCBI-ProteinID: AEB15400
UniProt: F2NWT1
Position
complement(2707598..2708257)
Genome map
AA seq 219 aa AA seqDB search
MNFTGLIPAFLICTIPVLAALACMVVLIKEFKLGFGFVAVFCGLFAVVPIYAIQFFMETS
GLINLHSLFSVLIKSILVNGVVEETIKMAVFFIFPSKKMSMKVFFACAVLSGLSLGCFET
LIYIASGIKNLELRLLTAVVIHSCCAGLSGLFVFNLKNGSLKIYPFVLAVFLHGIYNYFA
GFKMDSMFFWFSLVVVLVAVVECRIRYRAMNPEGLILFR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaattttacaggtttgattccagcatttttaatttgcacaattcctgttttggcggca
ttggcttgcatggttgttcttataaaagaattcaagcttggctttggatttgttgctgtt
ttctgcggactttttgccgttgttccgatttatgcaattcagtttttcatggaaacttcc
gggttgattaatttgcattctcttttttctgttttgattaaaagcattcttgtgaatggc
gttgttgaggaaactataaaaatggcggtgttttttatttttccttcaaagaaaatgtca
atgaaagttttttttgcctgcgccgttttgagcggactttcgcttggctgctttgaaact
ttaatttacattgcttctggaataaaaaatcttgagcttaggcttttgactgcggttgtt
attcattcttgctgcgcaggactttcggggctttttgtttttaacttaaagaatggaagc
cttaaaatttatccgtttgttctggcggtttttctgcacggaatttacaattattttgct
ggatttaaaatggacagcatgttcttttggttttcgcttgttgtagttttggttgctgtt
gtggaatgccggattcgttacagggcaatgaatccggaagggctgattctttttcggtag

DBGET integrated database retrieval system