KEGG   Treponema succinifaciens: Tresu_2544Help
Entry
Tresu_2544        CDS       T01461                                 

Definition
(GenBank) NADPH-dependent FMN reductase
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: AEB15406
UniProt: F2NXR2
Position
complement(2712948..2713526)
Genome map
AA seq 192 aa AA seqDB search
MKILILNASPKPLGTISQMLKFLEDEIRRKNPSAEIENIRVSSLKFSACTGCMKCRSCGK
CVFAGDDADVAGEKIASADFLVVASPCWWGNMTGSLKSLFDRNVFRLMGESKHGIPLALL
KGKEAAIVTACTTPFPFNVICRQSPGVFSSIGEILKSAGIKITAKICASGTKQKPGLTMS
RKRKIVKVAKKI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattgattctaaacgcctctccaaaacctttaggaacaatttctcaaatgcta
aaatttcttgaagacgaaattcgccggaaaaatccatccgctgaaattgaaaatatccgc
gtatcttcactgaaattttccgcctgcacaggctgcatgaagtgccgctcttgtggaaaa
tgcgtttttgccggagatgacgcagatgttgcaggagaaaaaattgcaagcgcagatttt
cttgttgtggcttctccgtgctggtggggcaacatgaccggcagcttgaagtcgcttttt
gaccgcaacgttttccgcttgatgggagaatcaaagcacggaattccgcttgcgctcctc
aaaggtaaagaagccgcaatcgtaacagcctgcacaactccgtttccgtttaatgtgatt
tgcaggcagtcaccgggcgtttttagttcaatcggcgaaatcctaaaatcagccggaata
aaaatcaccgcaaaaatctgcgcgtccggaacaaagcaaaaaccgggacttacaatgagc
agaaaacgcaagattgtgaaggttgctaaaaaaatataa

DBGET integrated database retrieval system