KEGG   Treponema succinifaciens: Tresu_2548Help
Entry
Tresu_2548        CDS       T01461                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AEB15410
UniProt: F2NXR6
Position
complement(2715461..2716243)
Genome map
AA seq 260 aa AA seqDB search
MKKNMNDELARIKSEPALSQELFRRREYSIYHLEYDKELAFYDAVKKGDFDLVKRLMLPL
RNEKLGKLSENPLRNLKYHLVITVAMITRFCIEGGLPPEPAYTLSDIYIRQIDSAGDEDT
ITMLHREAVFDFTSRMKELKEVHGLSRRTTAAIDYIYDHLNEKIQLFRMAETLGVNKTYL
CALFRRETGITVGQYVMKKKIEAAEKMLLYSENSSAQISALFSFSSASHFIEIFKKETGL
TPSHYRKIRRSEAFTTMAEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaacatgaacgatgagcttgcgcgcataaagtccgagcctgcgctctcacag
gagcttttcagacggcgggaatattcaatctatcacctggaatacgacaaggagcttgcg
ttctatgatgctgtgaagaagggcgactttgaccttgtgaaacgcctgatgcttccactg
cgcaacgaaaagctcggaaaactctcggaaaatccgctgcggaacctcaagtatcatctt
gtgataacggtcgcgatgataacccggttctgcattgagggaggtcttccgcctgaaccg
gcatataccttgagcgacatctacatccgacagatagacagcgccggggacgaggacaca
atcaccatgctgcaccgcgaggctgtattcgatttcaccagccgcatgaaggagctcaag
gaagttcatggactttcgcgcagaacgacagccgcaatcgactacatctacgaccacctg
aacgagaaaatccagcttttccggatggcagagacgctcggcgtgaacaagacatatctc
tgcgctcttttcagaagggaaaccggaatcacagtcgggcaatatgtaatgaagaaaaaa
atcgaggcggcggagaaaatgcttctctacagtgaaaattcatccgcacagataagcgcg
ctcttctcgttcagctcggcaagccacttcatagaaatattcaaaaaagagacaggactc
actccgtcccactaccgaaaaatccggcgcagcgaagcattcaccacaatggcagaaaaa
tag

DBGET integrated database retrieval system