KEGG   Treponema succinifaciens: Tresu_2549Help
Entry
Tresu_2549        CDS       T01461                                 

Definition
(GenBank) glycoside hydrolase family 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00500  Starch and sucrose metabolism
tsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tresu_2549
Enzymes [BR:tsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tresu_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-ProteinID: AEB15411
UniProt: F2NXR7
Position
2716445..2717464
Genome map
AA seq 339 aa AA seqDB search
MNLSKGINFGGWLSQCRHTKEHYDSFINEDDVRRAAGWGFDHIRLPFDSEVVQNPDGTFI
EEGFSRLEKFVGWAEDSGLDVVLDLHKACGYDFNDAGTENGNPLFSSPHLQELFVSLWNE
VSSRFGGKKNVAFEFLNEVVEQEAAEPWNTLIDRTLSVIRKNAPETPVIYGGIQWNSART
LRLLRKPEFRNVIFTFHFYEPLIFTHQKAPWVPGMSPDREIKYPASLSYFREESVPLGYK
GKDVADTDGNLPGIELMRQMIGEACAAAENAGVPVYCGEYGVIDRAPVKGTEAWFADVHK
IFREFGVGHAVWTYKEMDFGLTESHYDGIRASLIKMMTE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttcaaagggaataaatttcggaggatggctttcgcagtgccgccacacaaag
gagcattacgacagttttataaatgaggacgatgtgcgccgtgccgccggctggggcttt
gaccacataaggcttccgttcgacagcgaggttgtccagaatccggacggaactttcatt
gaggaaggattttcgcggctggaaaaatttgtcggatgggcggaagattccgggcttgat
gtggtccttgaccttcacaaggcttgcggctacgacttcaacgacgcgggaacggaaaat
ggaaacccgcttttttcaagtccgcatcttcaggagcttttcgtgtcgctttggaatgaa
gtctcgtcaagattcggcggaaaaaagaacgtcgcgtttgagtttctgaacgaggttgtg
gagcaggaggcagctgagccttggaacaccctcattgaccgcacactcagcgtaatcaga
aagaatgctcctgaaactccggtgatttacggcggaatccagtggaacagcgcgcgcact
ctccgccttttaaggaagccagaattccgcaacgttattttcaccttccatttttacgag
ccgctgattttcacgcatcagaaagcgccctgggttccgggaatgagccccgaccgcgag
ataaaataccctgcctcgctgtcatatttccgcgaggaatccgttccgctcggatacaag
ggaaaagatgtcgccgacactgacggaaatcttccgggaatcgagcttatgcggcagatg
attggggaggcttgcgcggctgctgaaaacgccggagttcccgtctactgcggagaatat
ggagtgattgaccgcgcgcccgtcaagggaacagaagcctggttcgccgatgtgcataaa
attttcagggaattcggtgtgggacacgcggtgtggacctataaggagatggacttcgga
cttacggaaagccactacgacggaatccgcgccagtcttataaaaatgatgaccgaataa

DBGET integrated database retrieval system