KEGG   Candidatus Thiodictyon syntrophicum: THSYN_01585Help
Entry
THSYN_01585       CDS       T05211                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tsy03016]
    THSYN_01585
Enzymes [BR:tsy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     THSYN_01585
Transfer RNA biogenesis [BR:tsy03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    THSYN_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DUF3562
Motif
Other DBs
NCBI-ProteinID: AUB79777
UniProt: A0A2K8U2K2
Position
375327..376067
Genome map
AA seq 246 aa AA seqDB search
MEILYLDDVMIAVHKPSGLLVHRSLIDKHETRFALQLVRDQVGRRVYPVHRLDKPTSGIL
VFALDPATARALNDQFTAGLVQKTYRAIVRGYTDQAGVIDYALREELDKIADALADPDKA
PQQAITHYRRLCTAELPHPVGRYGTARYSLVELQPKTGRKHQIRRHLRHIFHPVIGDTTH
GDGRHNQFFRDHFGNQRLLLAATALHLIHPHSGEPLAMRTAPGADFARIVNALGWGEVAR
VSGKDC
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctgtacttagacgacgtcatgatcgcggtgcacaagccgtccggcttgctc
gtccaccgcagcctcatcgacaagcacgagacccgcttcgccctgcaactggtgcgcgac
caggtcggccggcgcgtctatccggtgcatcgcctcgataagcccacctccggtatcctg
gtgttcgccctcgacccggcgaccgcccgcgcgctcaatgaccagttcaccgcggggctg
gtgcagaagacctaccgcgccatcgtgcgcggttacacggatcaggccggcgtgatcgac
tatgccctgcgcgaggagctcgataagatcgcggacgcgctcgccgatccagacaaggcc
ccccagcaggcgatcacccactatcggcgtctctgcaccgccgagctgccgcatcccgtt
ggccgttatggcaccgcccgttactcgctcgtcgagctgcaaccgaaaaccggtcgcaag
catcagatccgccggcacctgaggcacatcttccatcccgtcatcggcgacaccacgcac
ggcgacggccgccacaaccagttctttcgcgatcacttcggcaaccagcgcctgctgttg
gcagcgaccgcgctgcatctcatccatccgcacagcggagagccgctggcgatgaggaca
gccccgggggcagacttcgcgcgtatcgtcaacgcgctcggctggggagaggtggcaaga
gtgtccggcaaggattgctga

DBGET integrated database retrieval system