KEGG   Candidatus Thiodictyon syntrophicum: THSYN_01735Help
Entry
THSYN_01735       CDS       T05211                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tsy  Candidatus Thiodictyon syntrophicum
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    THSYN_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR DUF1495
Motif
Other DBs
NCBI-ProteinID: AUB79807
UniProt: A0A2K8U2N2
Position
complement(408379..409506)
Genome map
AA seq 375 aa AA seqDB search
MLTLLIAVVLTALVFEYINGFHDTANSIATVVATKVLAPMQAVALAATTNLIGALWGTAV
AKTIATGLLDQGVVEVTSQVIICALIGGIVWNLVTWYLGLPSSSSHALIGGLCGAAIAAA
HGQWGAVIWSQPTDPWYKGAGILWKVVVPMVSSPVAGFVGGYLLMGVLFALFWAMSRSGG
VLMRIARPRWGNAFFGKAQLVSAGYMGLAHGLNDAQKTMGIIALALVSAHQAGTLATLPT
WLDWMRPSETALAHGDIDLWIKLTCAVTMAAGTAVGGWRIIKTLGHKLVHLHPIHGFAAE
TSAATVITIASSLGIPVSTTHNISAAIMGVGAAKRFSAVRWTVVERMLWAWLLTIPAAGG
IAYGLVKVLQAFGLD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgcttctcatcgcggtggtcctcaccgccctcgtcttcgagtacatcaacggc
ttccacgacaccgccaactccatcgccacggtggtcgcgaccaaggtgctggcgccgatg
caggcggttgcactcgccgccaccaccaacctgatcggggccctctggggcaccgccgtg
gccaagaccatcgccaccggactgctggaccagggcgtcgtcgaggtcacctcccaggtc
atcatctgcgccctgatcggcggcatcgtctggaacctggtgacctggtacctgggcctg
ccgtcctcctcctcccacgccctgatcggcggcctgtgcggcgccgcgattgccgccgcc
catggacaatggggggccgtgatctggtcccagcccaccgacccctggtacaaaggcgcc
gggatcctctggaaggtggtggtaccgatggtcagcagcccggtcgcgggcttcgtcggc
ggttacctgttgatgggggtgctgttcgccctcttctgggccatgtcgcgcagcggcggg
gtcctcatgcgcatcgcccgcccccgctggggcaacgccttcttcggcaaggcgcagctc
gtctccgcgggctacatgggcctggcccacggcctcaacgacgcgcagaagaccatgggc
atcatcgccctcgcgctggtttcggcccaccaggccgggaccctcgccaccctgccgacc
tggctcgactggatgcgcccgagcgaaacggcgctcgcccacggcgacatcgacctctgg
atcaagctcacctgcgccgtcaccatggccgccgggaccgcggtgggcggctggcggatc
atcaagaccctgggccacaagctggtgcacctgcaccccatccacggcttcgccgccgag
acctccgccgccaccgtcatcaccattgcctccagcctcggcatccccgtctccaccacc
cacaacatctccgccgccatcatgggggtgggggccgccaagcgcttctccgccgtgcgc
tggaccgtggtcgagcggatgctatgggcctggcttctgaccatcccggcggctggcggc
attgcctatggattggtgaaagtgctgcaggcgtttgggttggattga

DBGET integrated database retrieval system