KEGG   Candidatus Thiodictyon syntrophicum: THSYN_08625Help
Entry
THSYN_08625       CDS       T05211                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00860  Porphyrin and chlorophyll metabolism
tsy01100  Metabolic pathways
Module
tsy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THSYN_08625
Enzymes [BR:tsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     THSYN_08625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 SnoaL_2
Motif
Other DBs
NCBI-ProteinID: AUB81008
UniProt: A0A2K8U5Z1
Position
complement(2039283..2039885)
Genome map
AA seq 200 aa AA seqDB search
MSDTLIDLIRHGEPVGGRQFRGDSVDDPLSAAGWAQLRAALGEACPWDQVISSPMARCRP
FAMEVAARHGLPLAIEPALREIGMGDWERRTPADLAAHDPAAFAALYRDPAAHRPPGGEP
LAAFTTRVATAYDRQAALYPGRHLLIVCHSGVMRAVVGYLLGAADARWYRLRIDYAGLVR
VRHGRFGAAIECVNAPTLPG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacacactgatagacctgatccggcacggggagcccgtgggcgggcgacagttc
cgcggcgacagcgtggatgacccgctgtccgcggccggctgggcgcagttgcgcgcggcc
ctgggggaggcctgcccctgggatcaggtcatcagctcgcccatggcccgctgtcgcccc
tttgccatggaagtggccgctcgccacggcctgccgctggcgatcgaaccggcgctccga
gagatcggcatgggcgactgggagcgccgcacgcctgctgacctggcggcgcacgacccc
gccgccttcgcggcactgtaccgggacccggccgcccatcgcccgccggggggcgagccc
ttggcggccttcaccacccgcgtcgcgacggcctacgaccggcaggcggcgctctacccg
ggccggcacctcctgatcgtctgccacagcggggtgatgcgcgcggtggtgggatacctg
ctgggggccgccgacgcgcggtggtatcggctgcggatcgactacgcggggctggtgcgg
gtgcgccacgggcgcttcggggccgccatcgagtgtgtcaacgcgccgaccctgcccggc
tga

DBGET integrated database retrieval system