KEGG   Candidatus Thiodictyon syntrophicum: THSYN_17785Help
Entry
THSYN_17785       CDS       T05211                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00860  Porphyrin and chlorophyll metabolism
tsy01100  Metabolic pathways
tsy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THSYN_17785
Enzymes [BR:tsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     THSYN_17785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AUB82612
UniProt: A0A2K8UAL3
Position
complement(4273705..4275090)
Genome map
AA seq 461 aa AA seqDB search
MEQGISFDLGLIRRYDQSGPRYTSYPTAVEFDERFDEAAYKAACARSNLSGRPLSLYFHL
PFCDTVCFYCACNKIATKDRSLAPPYLERLHKEIAMQSALFDRHRVVEQLHWGGGTPTFL
SHDQMQGLMDQTRRHFTLADDAVGEFSIEIDPREADAATVALLRRIGFNRMSLGVQDFDP
RVQAAVNRIQTEAETLEVLDAARAQGFRSISLDLIYGLPLQTAASFLSTLDRIIELTPDR
ISVFNYAHLPTRFKAQRRINETDLPAPEVKLEILQSTIARLGEAGYVYIGMDHFARPDDE
LAQAQRAGTLYRNFQGYSTHADCDLIGLGVTSIGKVDNTYGQNRRELDEYYADLDADRLP
VFRGLTLNRDDLIRRDVITRLICNFQLSMPAVETAWDIVFADYFADALKRLEVMVGDGLL
QIEDGTIRILPRGRLLVRNICMAFDAYLANKSGPIGFSKVI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaacagggtatctcctttgacctgggcctgatccgccgctatgaccagagcggcccc
cgttacacctcctacccgacggcggtggagttcgacgagcgcttcgacgaagccgcctat
aaggctgcctgtgcgcgcagtaacctgagcgggcggcccttgtcgctgtattttcacctg
ccgttttgcgatacggtctgcttttactgtgcctgcaacaagatcgccaccaaggaccgc
agcctggccccgccctatctggagcgcttgcacaaggagatcgcgatgcagtcggcgctc
ttcgaccgccatcgggtcgtcgagcaactccactggggcggcggcaccccgaccttcctg
agccacgaccagatgcaggggctgatggatcagacccgccgccacttcaccctggcggac
gatgccgtcggcgaattctccatcgagatcgacccgcgcgaggcggatgccgcgaccgtc
gccctgttgcggcgcatcggcttcaatcgcatgagcctgggggtgcaggacttcgacccg
cgtgtccaggcggcggtcaaccgcatccagaccgaggcggagacgctcgaggtcctggat
gcggcgcgcgcccagggcttccgctccatcagcctcgacctgatctacggcctgccgctg
cagaccgcggcgagctttcttagcaccctggaccgcatcatcgagctgaccccggaccgt
atctcggtcttcaactacgcccacctgccgacgcgcttcaaggcccagcgccgcatcaac
gagaccgacctgccggccccggaggtgaagcttgagatccttcagagcaccatcgcgcgc
ctgggtgaggccggctatgtctatatcggcatggaccacttcgcccgcccggacgacgag
ttggcccaggcccagcgcgccggtaccctctatcgcaacttccagggctactccacccac
gccgactgcgacctcatcgggctcggggtcacctccatcggcaaggtggacaacacctac
gggcagaaccggcgcgaactcgacgagtattacgccgacctcgacgccgaccgcctgccg
gtcttccgcggactgacgctcaatcgcgacgacctgatccgccgcgatgtcatcacccgg
ctgatctgcaacttccaactctccatgccggccgtggagaccgcctgggacatcgtgttc
gcggactatttcgcggatgccttgaaacgcctggaggtcatggtcggcgatggactgctc
cagatcgaggacggcaccatccgcatcctgccgcgcggacgcctcctggtgcgcaacatc
tgtatggccttcgatgcctatctggcgaacaaatccggccccattgggttctccaaggtt
atctag

DBGET integrated database retrieval system