KEGG   Candidatus Thiodictyon syntrophicum: THSYN_19970Help
Entry
THSYN_19970       CDS       T05211                                 

Definition
(GenBank) pyruvate carboxylase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00020  Citrate cycle (TCA cycle)
tsy00620  Pyruvate metabolism
tsy01100  Metabolic pathways
tsy01120  Microbial metabolism in diverse environments
tsy01200  Carbon metabolism
tsy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THSYN_19970
   00620 Pyruvate metabolism
    THSYN_19970
Enzymes [BR:tsy01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     THSYN_19970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_5 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AUB82999
UniProt: A0A2K8UC37
Position
4778347..4779765
Genome map
AA seq 472 aa AA seqDB search
MLRKILIANRGEIAVRVIRACAEMGIRSAAVYSEADRHSLHVKKADEAYSLGADPLAGYL
NVHNLVTLALSTGCDAIHPGYGFLAENPELAIACTRRGITFIGPTAEVISRMGDKTQARF
AMQKAGVPITPGSAGNLEDLEQALRVAAEIGYPIMLKATSGGGGRGIRRCDDAAALRRNF
ERVISEATKAFGRAEVFLEKCVVNPRHIEVQVLGDHHGHCIHLFERDCSIQRRNQKLIEI
APSPQIDEAQRQYVGGLAVLAARAVGYTNAGTVEFLQDTDGRFYFMEMNTRIQVEHTVTE
TITGVDLVEEQIRVAAGLPLRFQQHEISRRGVAMQFRINAEDPKNNFLPSFGRISRYYAP
GGPGVRTDTCIYTGYTVPPHYDSMLAKVIVWALSWEDVLNRGARALKDMGVFGIKTTMPF
YQEILRHPQFRSGHFDTGFLDAHPELLTYSEKRRKEDIAAALAAAIAAHAGL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaaagatcctgatcgccaaccgcggcgagattgcggtgcgcgtgatccgcgcc
tgtgccgaaatggggatccgctcggccgccgtctattctgaggcggaccgccactcgctg
cacgtcaagaaggccgacgaggcctacagcctgggcgccgaccccctggccggctatctc
aacgtccacaacctcgtgacgctggccctttcgaccgggtgtgacgccatccatcccggc
tacggtttcctcgccgagaatccggaactggccatcgcctgcacccgccgcggcatcacc
ttcatcggccccaccgcggaggtgatcagccgcatgggcgacaagacgcaggcgcgcttt
gccatgcagaaggcgggggtacccatcaccccgggcagcgccgggaacctcgaggacctg
gagcaggcgctgcgggtcgcggcggagatcggctacccgatcatgctcaaggccacctcc
ggcggcggcgggcgaggcatccgccgctgcgacgacgccgcggccctgcgccgcaacttc
gagcgggtgatctcggaggcgaccaaggccttcggccgcgccgaggtcttcctggagaag
tgcgtggtcaacccgcgccatatcgaggtccaggtcttgggcgatcatcacggccactgc
atccacctcttcgagcgcgactgctccatccagcggcgcaaccaaaagctgatcgagatt
gccccctccccccagatcgacgaggcgcagcgccagtatgtcggcggactcgcggtactg
gccgcgcgcgcggtcggctacaccaatgccgggaccgtggagttcctgcaagacacggac
gggcgtttctattttatggagatgaatacccgtatccaggtcgaacatacggtcaccgag
accattaccggggtagacctggtcgaggagcagattcgcgtggccgccggtttgccgctg
cgctttcagcagcacgagatcagccggcgcggcgtcgctatgcagtttcgcatcaatgcg
gaggatcccaagaacaacttcctgccgagcttcgggcggatctcgcgctattacgccccg
ggcggcccaggggtgcgcaccgacacctgtatctataccggctatacggtgccgccccat
tacgactccatgctcgccaaggtgatcgtctgggccctgtcctgggaggacgtactcaac
cgcggcgcccgcgccctgaaggacatgggcgtattcggcatcaagaccaccatgcccttc
taccaggagatcctgcgccatccgcagttccgctccgggcacttcgacaccggcttcctg
gacgcccacccggagttgttgacgtactccgagaagcgccgcaaggaagacatcgccgcc
gctctggcggccgccatcgcggcccatgcggggctctaa

DBGET integrated database retrieval system