KEGG   Candidatus Thiodictyon syntrophicum: THSYN_22645Help
Entry
THSYN_22645       CDS       T05211                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00520  Amino sugar and nucleotide sugar metabolism
tsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    THSYN_22645
Enzymes [BR:tsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     THSYN_22645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind adh_short Polysacc_synt_2 KR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AUB83470
UniProt: A0A2K8UD20
Position
complement(5391173..5392153)
Genome map
AA seq 326 aa AA seqDB search
MRTYNPRQRILVTGGAGFLGSHLIDRLLERGDEVVCADNLFTGTKRNVEHLHSHPRFEFI
RHDVTFPLYIEVDQIYNLACPASPIHYQHDPVQTTKTSVHGAINMLGLAKRLKARIFQAS
TSEVYGDPAVHPQTEDYWGNVNPIGLRSCYDEGKRCAETLFFDYYRQHRLDIRVARIFNT
YGPRMHPNDGRVVSNFIVQALRGEDITLYGDGLQTRSFCYVDDLIEGFIRYMDLPYGEDG
GPGHPGPLNLGNPGEFTIRQLAEMIIELIGARSRLVFLPLPADDPMQRKPDISRAREYLG
WEPLVPLDEGLKKTIAYFDELLCTGA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacctataatccccgccaacgcatcctcgtgacgggcggtgccggtttcctcggc
tcccacctgatcgaccgcctgctcgagcgcggcgacgaggttgtctgtgccgacaatctc
ttcaccggcaccaagcgcaacgtcgagcatctgcatagccacccgcgctttgaattcatc
cgccacgatgtcaccttcccgctctacatcgaggtcgaccagatctataacctggcctgt
cccgccagtcccatccactatcagcatgacccggtccagacgaccaagaccagtgtgcat
ggggccatcaacatgctgggcctggccaagcgactcaaggcgcgcatcttccaggccagc
accagcgaggtctatggcgaccccgccgtgcatccccagaccgaggactattggggcaac
gtcaatccgatcggcctgcgcagttgttacgacgaaggtaagcgctgcgccgaaaccctg
tttttcgactactaccgccagcatcggctcgatatccgggtcgcccgcatcttcaacacc
tacggcccgcggatgcacccgaacgacggtcgcgtggtcagcaacttcattgtgcaggcg
ctgcggggcgaggacatcaccctctacggcgacggcctccagacccgcagcttctgctat
gtcgatgatctgatcgagggatttatccgctatatggatttaccatatggcgaggacggg
gggccgggccaccccgggccgctcaacctgggcaacccgggcgaatttaccatccgccaa
ctggccgaaatgatcatcgaactgattggcgcccggtcacgacttgttttcctgccgctg
ccggcagatgaccccatgcagcgcaagccggacatctcgcgcgcccgtgagtatctgggc
tgggaaccgttggtgccgcttgatgaggggctgaaaaagaccatcgcctattttgacgaa
cttctctgcaccggcgcctga

DBGET integrated database retrieval system