KEGG   Candidatus Thiodictyon syntrophicum: THSYN_27595Help
Entry
THSYN_27595       CDS       T05211                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
tsy  Candidatus Thiodictyon syntrophicum
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    THSYN_27595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUB84328
UniProt: A0A2K8UFI5
Position
6482539..6482925
Genome map
AA seq 128 aa AA seqDB search
MEVQVQRHSIKVLARSQFQPEQSAPVEGRYAFSYTITIENDGSEPARLLDRHWIITDADG
KVQEVRGEGVVGEQPHLKPGERFRYSSGTILPTPVGCMHGSYGMVGDDGTRFDAEIPAFS
LASLARLH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggaggtccaagtgcagcgtcattcgatcaaggtcttggcccgcagtcagtttcagccg
gaacagtcggcccccgtggaggggcgctatgccttctcctacaccatcaccatcgaaaac
gacggcagcgagccggcccgtctgctcgaccgccattggatcatcaccgacgccgacggc
aaggtgcaggaggtccgcggtgagggcgtggtcggcgagcagcctcacctgaagcccggc
gagcgcttccgctacagcagcgggaccatcctgcccacgccggtcgggtgcatgcacggc
agctacggcatggtcggcgacgacgggacccggttcgacgccgagatcccggccttctcg
ctcgcctccctcgcccggctccactga

DBGET integrated database retrieval system